SecReT6
Protein ID: 84624957
SecReT6 ID117
T6SS typei4b
Gene symbol-
Locus tagXOO_3300
StrainXanthomonas oryzae pv. oryzae MAFF 311018
Repliconchromosome [GenBank: NC_007705] [Browse all T6SS(s) in this replicon]
Location [Strand]3755996..3757966 [+]
ProductVGR-like protein
NoteTssI
UniProt IDQ2P072
KEGG IDxom:XOO_3300
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.20E-34, Aligned region: 5..219
Phage_GPD [PF05954], Evalue: 1.20E-34, Aligned region: 495..636
T6SS_Vgr [PF13296], Evalue: 1.50E-30, Aligned region: 392..498
T6SS_Vgr [PF13296], Evalue: 1.50E-30, Aligned region: 575..595
DUF2345 [PF10106], Evalue: 1.00E-29, Aligned region: 102..184
DUF2345 [PF10106], Evalue: 1.00E-29, Aligned region: 457..490
DUF2345 [PF10106], Evalue: 1.00E-29, Aligned region: 544..651
Phage_base_V [PF04717], Evalue: 1.70E-16, Aligned region: 263..372
Protein Sequence: 656 a.a.     [Download]
>gi|84624957|ref|YP_452329.1| VGR-like protein [Xanthomonas oryzae pv. oryzae MAFF 311018]
MPEDARAICERIFADYPQAAFRFDVQAALPAHPITTQYRETDWAFVTRLLAEAGLAWRYAHAQDADSQAT
AATLVIFDPQAQAPDSGTIRFHRSDLAEADDAIGAFGERRGVVPTASTVTSWHSEQVRAVGAQAQAEAGA
LPPLEVYVQPRAGRFAQEATAQDQAQARLDALRVPHTLHAGAGSARVLAAGAAFTLRQHAQHDGQRFVPV
AIEHVAVNNLGQGIVALLDAPELEHGSYRNRFLAVPAATPLRALPQDRPRMPGPQSARVVGVADAALSPS
RDHQVRIQFPWQRGDQPAPGGLTDSASTAPGHAPGDQRAGTWVPVAEWVAGPNWGSHFLPRIGSEVLVEF
LHGDIDQPRITGQLYNGELAPPFGGGLDAHASHPGTLSGLHTQSHDGSGTQQWLLDDTPGQLRTRLHTSL
ADTRLELGYLVQHSDTARGALRGQGFELASQGWGNVHAAQGLLLSSSARGQGASTALDVAEAVAQLHGAQ
RTAQALHATLTQQQVPGLDAHPSVTRLREAIDPQAQGKYTAAVGGQAATKPADGGRDGQAPVERFAQARL
LGESPDHIAWTTPASAVAYAGQALQLTVQQDAQLSAGQTLSAVSGQHTALFAQRGPIKLIAAAGPVSLQA
HTGALELLADQAVTVTATDTDTRASC
 
Nucleotide Sequence: 1971 bp     [Download]
>gi|84621657|ref|NC_007705.1|:3755996-3757966 Xanthomonas oryzae pv. oryzae MAFF 311018 chromosome, complete genome
ATGCCTGAGGACGCGCGCGCGATCTGCGAACGGATCTTCGCCGACTACCCGCAGGCCGCGTTCCGCTTCG
ACGTGCAGGCCGCGTTGCCGGCGCACCCGATCACCACCCAATACCGCGAGACCGACTGGGCCTTCGTCAC
CCGCCTGCTGGCCGAGGCCGGCCTGGCCTGGCGCTACGCGCACGCGCAGGACGCCGACAGCCAGGCCACC
GCGGCCACGCTGGTGATCTTCGACCCGCAGGCGCAGGCGCCGGACAGCGGCACGATCCGCTTCCACCGCA
GCGACCTGGCCGAGGCCGACGATGCGATCGGCGCCTTCGGCGAGCGCCGCGGCGTCGTGCCCACCGCCAG
CACGGTGACCAGCTGGCACAGCGAGCAAGTGCGCGCGGTCGGCGCGCAGGCCCAGGCCGAGGCCGGCGCG
CTGCCGCCGCTGGAGGTCTACGTGCAGCCGCGCGCCGGGCGTTTCGCCCAGGAAGCGACCGCGCAGGATC
AGGCGCAGGCGCGGCTGGACGCGCTGCGCGTGCCGCACACGCTGCACGCCGGGGCCGGCAGCGCCCGCGT
GCTGGCGGCCGGGGCGGCGTTCACCTTGCGCCAGCACGCCCAGCACGACGGCCAGCGTTTCGTTCCGGTG
GCGATCGAGCACGTGGCGGTGAACAACCTGGGCCAGGGCATCGTCGCCCTGCTGGACGCGCCGGAGCTGG
AGCACGGCAGCTACCGCAACCGCTTCCTGGCGGTGCCGGCGGCCACGCCGCTGCGCGCGCTGCCGCAGGA
CCGCCCGCGCATGCCCGGGCCGCAGAGCGCGCGCGTGGTCGGCGTGGCCGACGCGGCGCTGAGCCCGAGC
CGCGACCACCAGGTGCGGATCCAGTTCCCGTGGCAGCGCGGCGACCAGCCCGCCCCGGGCGGGTTGACCG
ACAGCGCCAGCACCGCGCCCGGCCACGCGCCGGGCGACCAGCGCGCCGGCACCTGGGTGCCGGTGGCCGA
GTGGGTGGCCGGCCCGAACTGGGGCAGCCACTTCCTGCCGCGCATCGGCAGCGAAGTGCTGGTGGAGTTC
CTGCACGGGGACATCGATCAGCCGCGCATCACCGGCCAGTTGTACAACGGCGAGCTCGCCCCACCCTTCG
GCGGCGGCCTGGACGCGCATGCCAGCCACCCCGGCACGCTCAGCGGCCTGCACACCCAGTCCCACGACGG
CAGCGGCACCCAGCAATGGCTGCTGGACGACACCCCCGGCCAGCTGCGCACGCGCCTGCACACCTCGCTG
GCCGACACCCGGCTGGAACTGGGCTACCTGGTCCAGCACAGCGACACCGCCCGCGGCGCGCTGCGCGGCC
AGGGCTTCGAACTGGCCTCCCAGGGCTGGGGCAACGTGCATGCCGCGCAAGGCCTGCTGCTGTCCAGCAG
CGCCCGCGGCCAGGGCGCCTCGACCGCATTGGACGTGGCCGAGGCGGTGGCCCAGTTGCACGGCGCCCAA
CGCACCGCTCAGGCGCTGCACGCCACCCTGACCCAGCAACAGGTGCCCGGCCTGGACGCCCATCCCAGCG
TGACCCGGCTGCGCGAGGCCATCGACCCGCAAGCGCAGGGCAAGTACACCGCTGCGGTCGGCGGCCAGGC
GGCGACCAAGCCGGCCGACGGCGGCCGCGACGGCCAGGCACCGGTGGAACGCTTCGCCCAGGCGCGCCTG
CTCGGCGAGTCGCCGGACCACATCGCCTGGACCACCCCGGCCAGCGCGGTGGCCTATGCCGGGCAGGCCC
TGCAATTGACCGTGCAGCAGGATGCGCAGCTGAGCGCCGGGCAGACCCTGTCGGCGGTGTCCGGCCAGCA
CACCGCGCTGTTCGCCCAACGCGGACCGATCAAACTCATCGCCGCCGCCGGCCCGGTGAGCCTGCAGGCG
CATACCGGCGCGCTGGAACTGCTGGCCGACCAGGCGGTGACCGTCACCGCCACCGACACCGACACCCGCG
CTAGCTGTTGA