SecReT6
Protein ID: 84624961
SecReT6 ID117
T6SS typei4b
Gene symbol-
Locus tagXOO_3304
StrainXanthomonas oryzae pv. oryzae MAFF 311018
Repliconchromosome [GenBank: NC_007705] [Browse all T6SS(s) in this replicon]
Location [Strand]3762012..3764681 [-]
ProductVGR-like protein
NoteTssI
UniProt IDQ2P068
KEGG IDxom:XOO_3304
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.00E-37, Aligned region: 78..303
Phage_GPD [PF05954], Evalue: 1.00E-37, Aligned region: 761..847
DUF2345 [PF10106], Evalue: 3.80E-37, Aligned region: 697..855
T6SS_Vgr [PF13296], Evalue: 2.80E-34, Aligned region: 532..638
T6SS_Vgr [PF13296], Evalue: 2.80E-34, Aligned region: 797..819
Phage_base_V [PF04717], Evalue: 1.80E-24, Aligned region: 375..472
YiaAB [PF05360], Evalue: 0.00066, Aligned region: 18..38
YiaAB [PF05360], Evalue: 0.00066, Aligned region: 57..79
Protein Sequence: 889 a.a.     [Download]
>gi|84624961|ref|YP_452333.1| VGR-like protein [Xanthomonas oryzae pv. oryzae MAFF 311018]
MRTRIANHSSVAFVGALWVGLLLFGVFAAVSVQKSVRDRVDGIGVTAIHHGEAGCSVVAALSLLTVGLCN
ATPPLSAKIVEAVFADYAPMASWQWSEETSAFLAQARPRSYCVQYRESDLDFVQRLLAEEGLGWRLQEAD
ASPGGHQLVVFADSAAQPQDPSSAQGGGLRYHRSDATEAADSVLAIGATRRLGSGRLTVLSEDFKTRQAR
SAQLPLHGGGRQSLREVYEPVGMDAFASAQAADRSAELMAQAHEAQWSPWQGRSTVRTLRAGTWFTLTQS
PQQGQAPPAQLLLTRVWHAGINNLPVDVRAAVQSQLGAAPAWPDASAVAARSTWAQAEAVGYGNAFEAVD
RQQPWRPVLADGTGARLHPRPTAPGYQSAIVVGADGSTGGSQEVHADALGRIRVRFHFQHAASAPAAQDS
TWLRVAQRYAGPGVGSQFLPRIGQEVLVGFLEGDIDRPVVLGALYNGKGEAGVPATPGGTSAEADTGLYA
KAGDGRPSAQGNLAGGHAPAWHGAGGGADNHRNATALWGVQSKEWGGAGHSRLVFDDSDQQLRLQLATTQ
AATQLNLGHLIHQADNYRGSFRGEGFELRTDAWGAVRASSGLWLSSYGRSGGPAGEATQPSALLSQLQTL
GKTFSQAAGTHQTVKLAAHEGVGQANHSQLIAEQAPLPALLTSVKTTVPGTAYADAKGAAAERRASPGDD
RVPHTGDALLGLAAPAGIGVVAGQGLSWSVGETLTLASGAGSEAAIAGDARLHSGQAIGVLAAAVDGRQT
QANSLSLVSGEGALDVQAQSDDVRVQSKEGLKLISANADVALAAGKTLHLAVAGGASVTIEGGNITVACP
GTITVHASKKSFVGPVQHAYPLPAFAKSVCIPCLLQAMGKGHALSPVNG
 
Nucleotide Sequence: 2670 bp     [Download]
>gi|84621657|ref|NC_007705.1|:c3764681-3762012 Xanthomonas oryzae pv. oryzae MAFF 311018 chromosome, complete genome
ATGCGAACGCGTATTGCCAACCATTCGTCCGTGGCCTTCGTCGGCGCGTTGTGGGTGGGGCTGCTGCTGT
TCGGCGTATTCGCGGCGGTATCGGTACAGAAGAGCGTGCGCGATCGCGTCGACGGCATCGGCGTGACGGC
GATCCACCATGGAGAGGCCGGGTGTTCGGTCGTCGCCGCGCTGTCGCTGCTGACCGTCGGTCTGTGCAAC
GCGACGCCGCCTCTGAGCGCAAAAATCGTGGAAGCGGTGTTCGCCGACTACGCGCCGATGGCAAGCTGGC
AGTGGAGCGAGGAGACGAGCGCGTTCCTGGCCCAGGCGCGGCCGCGCAGCTACTGCGTGCAGTACCGCGA
GAGCGACCTGGATTTCGTGCAGCGGCTGCTGGCCGAGGAAGGCCTGGGCTGGCGGCTGCAGGAGGCGGAC
GCGTCGCCCGGCGGGCACCAGCTGGTGGTGTTCGCCGACAGCGCCGCGCAACCGCAGGACCCCAGTTCGG
CGCAGGGCGGGGGGCTGCGCTACCACCGCAGCGACGCCACCGAGGCGGCCGACAGCGTGCTGGCGATCGG
CGCCACCCGGCGGCTGGGCAGCGGCCGGCTGACGGTGCTCAGCGAAGACTTCAAGACGCGTCAGGCGCGC
AGCGCGCAGTTGCCGTTGCACGGCGGCGGCAGGCAGTCGCTGCGCGAGGTGTACGAGCCGGTGGGGATGG
ACGCCTTCGCCAGCGCGCAGGCAGCAGACCGCTCTGCGGAGTTGATGGCGCAGGCGCACGAGGCGCAGTG
GTCACCGTGGCAGGGCCGCAGCACGGTGCGCACGCTGCGCGCCGGCACCTGGTTCACGCTGACCCAGTCA
CCGCAGCAGGGCCAGGCGCCGCCGGCGCAGCTGTTGCTGACGCGGGTGTGGCATGCGGGTATCAACAACT
TGCCGGTGGACGTGCGCGCGGCGGTGCAGTCGCAGTTGGGGGCCGCGCCGGCGTGGCCGGATGCCAGCGC
GGTGGCCGCACGCAGCACCTGGGCGCAGGCCGAGGCGGTGGGCTACGGCAACGCCTTCGAGGCGGTGGAC
CGGCAGCAGCCGTGGCGGCCGGTGCTGGCCGACGGCACCGGGGCGCGGCTGCACCCGCGGCCGACCGCGC
CGGGCTACCAGAGCGCCATCGTGGTCGGTGCCGATGGCAGCACCGGCGGCAGCCAGGAGGTCCATGCCGA
CGCGCTGGGCCGGATCCGGGTCAGGTTCCACTTCCAGCACGCCGCGTCGGCCCCGGCGGCGCAGGACAGC
ACGTGGCTGCGGGTGGCGCAGCGCTACGCCGGCCCGGGCGTGGGCAGCCAGTTCCTGCCGCGCATCGGCC
AGGAAGTGCTGGTGGGCTTCCTGGAGGGGGACATCGACCGTCCGGTGGTGCTGGGGGCGCTGTACAACGG
CAAGGGCGAAGCCGGCGTTCCCGCCACCCCCGGCGGCACCAGCGCCGAGGCCGACACCGGCCTGTACGCC
AAGGCCGGCGACGGCAGACCCAGCGCGCAGGGCAACCTGGCCGGCGGCCATGCCCCGGCCTGGCACGGCG
CCGGCGGCGGCGCGGACAACCACCGCAACGCCACCGCGCTGTGGGGCGTGCAATCCAAGGAATGGGGCGG
CGCTGGCCACAGCCGGCTGGTGTTCGACGACAGCGACCAGCAATTGCGCTTGCAACTTGCGACCACCCAG
GCAGCCACGCAACTGAACCTGGGGCACCTGATCCACCAGGCGGACAACTACCGCGGCAGCTTCCGCGGGG
AAGGCTTCGAACTGCGCACCGACGCGTGGGGCGCGGTGCGGGCCAGCTCGGGGCTATGGCTGAGCAGCTA
CGGCCGCAGCGGCGGCCCGGCCGGCGAGGCGACCCAGCCCAGCGCATTGCTGAGCCAGCTGCAGACGCTG
GGCAAGACGTTCTCGCAGGCGGCGGGCACGCACCAGACGGTGAAGCTGGCCGCGCACGAAGGCGTGGGCC
AGGCGAACCACTCCCAGCTGATCGCCGAGCAGGCGCCGCTGCCGGCGCTGCTGACCAGCGTGAAGACCAC
GGTGCCGGGCACGGCCTACGCCGACGCCAAGGGCGCGGCGGCCGAGCGCCGCGCCAGCCCGGGCGACGAC
CGGGTGCCGCATACCGGCGATGCGCTGCTGGGCCTGGCCGCACCAGCGGGGATCGGCGTGGTGGCCGGCC
AGGGCCTGAGCTGGAGCGTGGGCGAGACGCTGACGCTGGCCAGCGGCGCGGGCAGCGAAGCGGCCATCGC
CGGCGACGCCCGGCTGCACAGCGGCCAGGCAATCGGCGTGCTGGCCGCGGCGGTGGACGGCCGGCAAACG
CAAGCCAACAGCCTGAGCCTCGTCAGCGGCGAAGGCGCGCTGGACGTGCAGGCGCAGTCGGACGACGTGC
GCGTACAGTCGAAAGAAGGGCTGAAGCTGATCAGCGCCAACGCCGACGTGGCCCTGGCGGCGGGCAAGAC
CCTCCACCTGGCGGTGGCCGGCGGGGCCAGCGTGACCATCGAAGGCGGCAACATCACCGTCGCCTGCCCC
GGCACCATCACCGTGCATGCGAGCAAGAAGTCGTTCGTGGGGCCGGTGCAGCATGCGTATCCGTTGCCCG
CGTTCGCAAAGTCGGTCTGCATCCCGTGCCTGTTGCAGGCCATGGGCAAGGGGCACGCGTTGTCCCCGGT
GAATGGGTGA