SecReT6
Protein ID: 84624971
SecReT6 ID117
T6SS typei4b
Gene symbol-
Locus tagXOO_3314
StrainXanthomonas oryzae pv. oryzae MAFF 311018
Repliconchromosome [GenBank: NC_007705] [Browse all T6SS(s) in this replicon]
Location [Strand]3774535..3777351 [-]
ProductVGR-like protein
NoteTssI
UniProt IDQ2P058
KEGG IDxom:XOO_3314
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.50E-60, Aligned region: 40..354
Phage_GPD [PF05954], Evalue: 1.50E-60, Aligned region: 851..897
DUF2345 [PF10106], Evalue: 6.10E-37, Aligned region: 748..906
T6SS_Vgr [PF13296], Evalue: 8.40E-34, Aligned region: 583..689
T6SS_Vgr [PF13296], Evalue: 8.40E-34, Aligned region: 848..869
Phage_base_V [PF04717], Evalue: 6.50E-24, Aligned region: 49..64
Phage_base_V [PF04717], Evalue: 6.50E-24, Aligned region: 426..523
Protein Sequence: 938 a.a.     [Download]
>gi|84624971|ref|YP_452343.1| VGR-like protein [Xanthomonas oryzae pv. oryzae MAFF 311018]
MEALNALMFQGALLSDSGRLYRLQLPGGDVQVVERWSGSERLSGGFEWWVDVLSTQAGLPLEAWLGRRAT
LYSRLADGDESPRTGLIHDAYALGSDGGLARYRVGLVPWTWWLSQGRHSRVFQERTLVQIVEAVFADYAP
MASWQWSEETSAFLAQARPRSYCVQYRESDLDFVQRLLAEEGLGWRLQEAAPSPGGHQLVVFADSVAQPQ
DPSSAQGGGLRYHRSDATEAADSVLAIGATRRLGSGRLTVLSEDFKTRQARSAQLPLHGGGRQSLREVYE
PVGMDAFASAQAADRSAELMAQAHEAQWSPWQGRSTVRTLRAGTWFTLTQSPQQGQAPPAQLLLTRVWHA
GINNLPVDVRAAVQSQLGAAPAWPDASAVAARSTWAQAEAVGYGNAFEAVDRQQPWRPVLADGTGARLHP
RPTAPGYQSAIVVGADGSTGGSQEVHADALGRIRVRFHFQHAASAPAAQDSTWLRVAQRYAGPGVGSQFL
PRIGQEVLVGFLEGDIDRPVVLGALYNGKGEAGVPATPGGTSAEADTGLYAKAGDGRPSAQGNLAGGHAP
AWHGAGGGADNHRNATALWGVQSKEWGSAGHSRLVFDDSDQQLRLQLATTQAATQLNLGHLIHQADNYRG
SFRGEGFELRTDAWGAVRASSGLWLSSYGRSGGPAGEATQPSALLSQLQTLGKTFSQAAGTHQTVKLAAH
EGVGQANHSQLIAEQAPLPALLTSVKTTVPGTAYADAKGAAAERRASPGDDRVPHTGDALLGLAAPAGIG
VVAGQGLSWSVGETLTLASGAGSEAAIAGDARLHSGQAIGVLAAAVDGGQTQANSLSLVSGEGALDVQAQ
SDDVRVQSKEGLKLISANADVALAAGKTLHLAVAGGASVTIEGGNITVACPGTITVHASKKSFVGPVQQA
YPLPQFPRSSCKSCILDAARQGTPGVLV
 
Nucleotide Sequence: 2817 bp     [Download]
>gi|84621657|ref|NC_007705.1|:c3777351-3774535 Xanthomonas oryzae pv. oryzae MAFF 311018 chromosome, complete genome
ATGGAAGCACTGAATGCATTGATGTTTCAGGGGGCCTTGCTGTCCGACAGCGGTCGCCTATACCGCTTGC
AGCTGCCTGGCGGGGATGTCCAGGTGGTGGAGCGCTGGAGCGGGTCGGAACGGCTGAGCGGCGGTTTTGA
GTGGTGGGTGGACGTGCTGAGCACGCAGGCGGGCTTGCCGCTGGAGGCGTGGCTGGGGCGGCGCGCGACG
CTGTACAGCCGGCTGGCCGATGGCGATGAAAGCCCGCGCACGGGGCTGATCCACGACGCGTACGCACTGG
GCAGCGACGGCGGGCTGGCGCGCTACCGGGTAGGCTTGGTGCCGTGGACGTGGTGGTTGTCGCAGGGCCG
GCACAGCCGGGTATTCCAGGAACGCACGCTGGTGCAGATCGTGGAAGCGGTGTTCGCCGACTATGCGCCG
ATGGCAAGCTGGCAGTGGAGCGAGGAGACGAGCGCGTTCCTGGCCCAGGCGCGGCCGCGCAGCTACTGCG
TGCAGTACCGCGAGAGCGACCTGGATTTCGTGCAGCGGCTGCTGGCCGAGGAAGGCCTGGGCTGGCGGCT
GCAGGAGGCGGCCCCGTCGCCCGGCGGGCACCAGCTGGTGGTGTTCGCCGACAGCGTCGCGCAACCGCAG
GACCCCAGTTCGGCGCAGGGCGGCGGGCTGCGCTACCACCGCAGCGACGCCACCGAGGCGGCCGACAGCG
TGCTGGCGATCGGCGCCACCCGGCGGCTGGGCAGCGGCCGGCTGACGGTGCTCAGCGAAGACTTCAAGAC
GCGTCAGGCGCGCAGCGCGCAGTTGCCGTTGCACGGCGGCGGCAGGCAGTCGCTGCGCGAGGTGTACGAG
CCGGTGGGGATGGACGCCTTCGCCAGCGCGCAGGCAGCAGACCGCTCTGCGGAGTTGATGGCGCAGGCGC
ACGAGGCGCAGTGGTCACCGTGGCAGGGCCGCAGCACGGTGCGCACGCTGCGCGCCGGCACCTGGTTCAC
GCTGACCCAGTCACCGCAGCAGGGCCAGGCACCGCCGGCGCAGCTGTTGCTGACGCGGGTGTGGCATGCG
GGTATCAACAACTTGCCGGTGGACGTGCGCGCGGCGGTGCAGTCGCAGTTGGGGGCCGCGCCGGCGTGGC
CGGATGCCAGCGCGGTGGCCGCACGCAGCACCTGGGCGCAGGCCGAGGCGGTGGGCTACGGCAACGCCTT
CGAGGCGGTGGACCGGCAGCAGCCGTGGCGGCCGGTGCTGGCCGACGGCACCGGGGCGCGGCTGCACCCG
CGGCCGACCGCGCCGGGCTACCAGAGCGCCATCGTGGTCGGTGCCGATGGCAGCACCGGCGGCAGCCAGG
AGGTCCATGCCGACGCGCTGGGCCGGATCCGGGTCAGGTTCCACTTCCAGCACGCCGCGTCGGCCCCGGC
GGCGCAGGACAGCACGTGGCTGCGGGTGGCGCAGCGCTACGCCGGCCCGGGCGTGGGCAGCCAGTTCCTG
CCGCGCATCGGCCAGGAAGTGCTGGTGGGCTTCCTGGAGGGGGACATCGACCGTCCGGTGGTGCTGGGTG
CGCTGTACAACGGCAAGGGCGAAGCCGGCGTTCCCGCCACCCCCGGCGGCACCAGCGCCGAGGCCGACAC
CGGCCTGTACGCCAAGGCCGGCGACGGTAGACCCAGCGCGCAGGGCAACCTGGCCGGCGGCCATGCCCCG
GCCTGGCACGGCGCCGGCGGCGGCGCGGACAACCACCGCAACGCCACCGCGCTGTGGGGCGTGCAATCCA
AGGAATGGGGCAGCGCTGGCCACAGCCGGCTGGTGTTCGACGACAGCGACCAGCAACTGCGCTTGCAGCT
GGCCACGACCCAGGCAGCCACGCAACTGAACCTGGGGCACCTGATCCACCAGGCCGACAACTACCGCGGC
AGCTTCCGCGGGGAAGGCTTCGAACTGCGCACCGACGCGTGGGGCGCGGTGCGTGCCAGCTCGGGGCTAT
GGCTGAGCAGCTACGGCCGCAGCGGCGGCCCGGCCGGCGAGGCGACCCAGCCCAGCGCATTGCTGAGCCA
GCTGCAGACGCTGGGCAAGACGTTCTCGCAGGCGGCGGGCACGCACCAGACGGTGAAGCTGGCCGCGCAC
GAAGGCGTGGGCCAGGCGAACCACTCCCAGCTGATCGCCGAGCAGGCACCGCTGCCGGCGCTGCTGACCA
GCGTGAAGACCACGGTGCCGGGCACGGCCTACGCCGACGCCAAGGGTGCGGCGGCCGAGCGCCGCGCCAG
CCCGGGCGACGACCGGGTGCCGCATACCGGCGATGCGCTGCTGGGCCTGGCCGCACCAGCGGGGATCGGC
GTGGTGGCCGGCCAGGGCCTGAGCTGGAGCGTGGGCGAGACGCTGACGCTGGCCAGCGGCGCGGGCAGCG
AAGCGGCCATCGCCGGCGACGCCCGGCTGCACAGCGGCCAGGCAATCGGCGTGCTGGCCGCGGCGGTGGA
CGGCGGGCAAACGCAGGCCAACAGCCTGAGCCTGGTCAGCGGCGAAGGCGCGCTGGACGTGCAGGCGCAG
TCGGACGACGTGCGCGTGCAGTCGAAAGAAGGGCTGAAGCTGATCAGCGCCAACGCCGACGTGGCACTGG
CGGCGGGCAAGACCCTCCACCTGGCGGTGGCCGGCGGGGCCAGCGTGACCATCGAAGGCGGCAACATCAC
CGTCGCCTGCCCCGGCACCATCACCGTGCATGCGAGCAAGAAGTCGTTTGTGGGGCCGGTGCAGCAGGCG
TATCCGTTGCCGCAGTTTCCACGCAGCAGTTGCAAGAGCTGCATCCTGGATGCAGCGCGCCAAGGAACCC
CGGGAGTGCTGGTGTGA