SecReT6
Protein ID: 84624973
SecReT6 ID117
T6SS typei4b
Gene symbol-
Locus tagXOO_3316
StrainXanthomonas oryzae pv. oryzae MAFF 311018
Repliconchromosome [GenBank: NC_007705] [Browse all T6SS(s) in this replicon]
Location [Strand]3778301..3779374 [+]
Producthypothetical protein
NoteTssA
UniProt IDQ2P056
KEGG IDxom:XOO_3316
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.70E-25, Aligned region: 54..113
Protein Sequence: 357 a.a.     [Download]
>gi|84624973|ref|YP_452345.1| hypothetical protein XOO_3316 [Xanthomonas oryzae pv. oryzae MAFF 311018]
MLDLDALLAPISDHQPAGEDLSFSIEFDRIQEARRSDDPTLDQGEWQTDIKYADWSSVARQCGDLLQTRT
KDLRLAGWMTEATTQIDGFAGLALGYRLIAGLCDRYWDEVHPLVVDGDHEERIGNLSWLLTNSLHWLRAV
PIASGPQGRFGLNAFEAAHTRSANAGSGDDEGQPSLDLLEAVRRDTPHDFYRQLVDALLNCAEALQSLQA
AVDDRLGIDGPSFSAVREQVEHLQRTVARFARDAGLLLDGEAEAGPHDMPGIGFGPAANKDAPSAPPPAP
REPGGAPTTRKEALAQLRQVAEFFRRTEPHSPVAYLAEKAARWGEMPLHVWLKRVIKDGSVLNQMEEMLD
VNQNLEQ
 
Nucleotide Sequence: 1074 bp     [Download]
>gi|84621657|ref|NC_007705.1|:3778301-3779374 Xanthomonas oryzae pv. oryzae MAFF 311018 chromosome, complete genome
ATGCTGGATCTGGATGCCCTGCTGGCGCCGATTTCCGACCATCAGCCGGCCGGCGAAGACCTGTCTTTCT
CCATCGAGTTCGATCGCATCCAGGAAGCCAGACGCTCGGACGATCCGACCCTGGACCAGGGCGAGTGGCA
GACCGATATCAAGTATGCGGACTGGTCCAGCGTCGCCCGCCAGTGCGGCGATCTGCTGCAGACGCGTACC
AAGGACCTACGCCTGGCCGGCTGGATGACCGAGGCGACCACCCAGATCGACGGCTTCGCCGGGCTGGCGC
TGGGTTACCGGCTGATCGCCGGGCTATGCGACCGGTACTGGGACGAGGTGCACCCGCTGGTCGTCGATGG
CGACCACGAAGAGCGCATCGGCAACCTGAGCTGGCTGCTGACCAATTCGCTGCATTGGTTGCGCGCGGTG
CCGATCGCCTCGGGACCGCAGGGCCGTTTCGGTCTCAACGCTTTCGAGGCCGCGCATACCCGCAGCGCCA
ATGCCGGATCCGGCGACGACGAAGGCCAGCCCAGCCTGGACCTGCTCGAGGCCGTACGGCGCGATACGCC
TCACGATTTCTACCGGCAGTTGGTCGATGCGCTACTCAATTGCGCCGAAGCGCTGCAGTCGCTACAGGCG
GCGGTGGACGATCGCCTAGGCATCGACGGACCCAGCTTCAGCGCGGTGCGCGAGCAGGTGGAACACCTGC
AGCGCACCGTGGCGCGGTTCGCCCGCGATGCTGGGCTACTGCTGGATGGCGAGGCCGAAGCCGGCCCGCA
CGACATGCCGGGCATCGGGTTCGGCCCGGCCGCGAACAAGGACGCGCCGTCGGCGCCGCCGCCGGCGCCA
CGCGAGCCGGGCGGCGCACCGACCACCCGCAAGGAAGCGTTGGCGCAGCTGCGTCAGGTCGCCGAATTCT
TCCGGCGTACCGAACCGCACAGCCCCGTCGCCTACTTGGCCGAAAAAGCCGCGCGCTGGGGCGAGATGCC
GCTGCACGTGTGGTTGAAGCGGGTTATCAAAGACGGCAGCGTCCTCAACCAGATGGAAGAGATGCTGGAC
GTCAACCAGAACCTGGAGCAGTAG