SecReT6
Protein ID: 84624974
SecReT6 ID117
T6SS typei4b
Gene symbol-
Locus tagXOO_3317
StrainXanthomonas oryzae pv. oryzae MAFF 311018
Repliconchromosome [GenBank: NC_007705] [Browse all T6SS(s) in this replicon]
Location [Strand]3779427..3780227 [-]
Productlipoprotein
NoteTagL
UniProt IDQ2P055, Q2P055
KEGG IDxom:XOO_3317
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 3.80E-23, Aligned region: 113..119
OmpA [PF00691], Evalue: 3.80E-23, Aligned region: 165..259
BON [PF04972], Evalue: 0.0003, Aligned region: 41..76
BON [PF04972], Evalue: 0.0003, Aligned region: 104..127
BON [PF04972], Evalue: 0.0003, Aligned region: 219..239
Protein Sequence: 266 a.a.     [Download]
>gi|84624974|ref|YP_452346.1| lipoprotein [Xanthomonas oryzae pv. oryzae MAFF 311018]
MRHLSAKTLALSGLITAFASSAQVAAPAATPATGGVGERPVIVEGVVPDQATKARILNNLRDTYGSARIV
DRVQVESIPSPPNWGEYVAKMVSPGLKRVAAGKLEVNGQAVRISGQVVNEAQRQQVASDLSLASNTSYTV
TNSLKLGGSEQGVLDQTLGNRIIEFQSGSSRLTPLGMRILDEMVEKMSQMKDARFLIIGHTDNVGQRESN
LALSQARAQAVKDYIVQKGIDGARMNVQGKGPDQPVADNASPDGRARNRRIQFKIQ
 
Nucleotide Sequence: 801 bp     [Download]
>gi|84621657|ref|NC_007705.1|:c3780227-3779427 Xanthomonas oryzae pv. oryzae MAFF 311018 chromosome, complete genome
ATGCGACACCTGAGTGCCAAAACCCTCGCCCTGAGTGGCCTGATAACCGCGTTCGCCTCCTCCGCCCAGG
TCGCCGCGCCTGCCGCCACGCCTGCCACTGGCGGTGTCGGCGAACGCCCGGTGATCGTGGAGGGCGTGGT
GCCGGATCAGGCCACCAAGGCCCGCATCCTGAATAACCTGCGTGACACCTACGGCAGTGCCCGCATCGTC
GATCGGGTGCAGGTCGAGTCGATTCCCTCGCCGCCGAACTGGGGCGAGTACGTCGCCAAGATGGTGTCGC
CAGGACTCAAGCGCGTGGCTGCAGGCAAGCTCGAGGTCAACGGCCAGGCGGTGCGGATCAGCGGGCAGGT
AGTCAACGAAGCGCAGCGGCAACAGGTCGCCAGTGACCTTAGCCTGGCCAGCAACACCTCCTACACGGTG
ACCAACAGCCTCAAGCTCGGCGGCTCGGAACAGGGCGTGCTGGACCAGACGCTGGGCAACCGCATCATCG
AGTTCCAGAGTGGCAGCTCGCGGCTGACGCCGCTGGGCATGCGCATCCTCGACGAGATGGTGGAAAAGAT
GTCGCAGATGAAGGACGCGCGCTTCCTGATCATCGGCCACACCGACAATGTCGGCCAACGCGAGAGCAAC
CTCGCGCTGAGCCAGGCGCGCGCGCAGGCGGTGAAGGACTACATAGTGCAGAAGGGCATCGACGGTGCGC
GCATGAACGTGCAGGGCAAGGGCCCCGACCAACCGGTGGCCGATAACGCCAGCCCGGACGGGCGTGCGCG
CAACCGGCGTATCCAGTTCAAGATCCAGTAG