SecReT6
Protein ID: 84624978
SecReT6 ID117
T6SS typei4b
Gene symbol-
Locus tagXOO_3321
StrainXanthomonas oryzae pv. oryzae MAFF 311018
Repliconchromosome [GenBank: NC_007705] [Browse all T6SS(s) in this replicon]
Location [Strand]3786504..3786764 [-]
Producthypothetical protein
NotePAAR
UniProt IDQ2P051
KEGG IDxom:XOO_3321
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 1.30E-22, Aligned region: 8..78
DUF4150 [PF13665], Evalue: 7.90E-08, Aligned region: 16..44
DUF4150 [PF13665], Evalue: 7.90E-08, Aligned region: 43..71
Protein Sequence: 86 a.a.     [Download]
>gi|84624978|ref|YP_452350.1| hypothetical protein XOO_3321 [Xanthomonas oryzae pv. oryzae MAFF 311018]
MSRPFIVVGDQLDHGGRVVTGSAETDVDGKPVARIGDKVVCNVHGQTEIASGDATVMIDGKPVARHGDKT
ACGGILISTQGTTGIG
 
Nucleotide Sequence: 261 bp     [Download]
>gi|84621657|ref|NC_007705.1|:c3786764-3786504 Xanthomonas oryzae pv. oryzae MAFF 311018 chromosome, complete genome
ATGTCACGACCTTTTATTGTTGTAGGCGATCAGCTCGATCATGGCGGGCGCGTGGTCACAGGTTCGGCCG
AAACCGATGTGGACGGCAAGCCGGTGGCGCGTATCGGCGACAAGGTGGTGTGCAACGTGCACGGTCAGAC
CGAGATCGCCAGCGGGGACGCCACGGTGATGATCGACGGCAAGCCGGTGGCTCGGCACGGCGACAAGACC
GCCTGCGGGGGTATACTTATCTCCACTCAGGGAACGACTGGCATCGGATGA