SecReT6
Protein ID: 89055511
SecReT6 ID118
T6SS typei5
Gene symbol-
Locus tagJann_3020
StrainJannaschia sp. CCS1
Repliconchromosome [GenBank: NC_007802] [Browse all T6SS(s) in this replicon]
Location [Strand]3038411..3040627 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDQ28MX5
KEGG IDjan:Jann_3020
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.80E-59, Aligned region: 34..343
Phage_base_V [PF04717], Evalue: 2.50E-20, Aligned region: 63..84
Phage_base_V [PF04717], Evalue: 2.50E-20, Aligned region: 382..475
DUF2345 [PF10106], Evalue: 8.50E-05, Aligned region: 642..692
Protein Sequence: 738 a.a.     [Download]
>gi|89055511|ref|YP_510962.1| unnamed protein product [Jannaschia sp. CCS1]
MNAEADFIQADRILRVETPLGDDVLLAEKLDLREVISGFFEGTLVARSKSRDLAPGDLLGSLVDVSVELG
GGERRSWNALVMGMTAGPKATRGLQSYTLMLRPEAWLLTQTSDCRIWLDKSSVDVAEALLGEHGITAPVI
GGITSPPPPKHYSVQYNETDWAYLVRRLEEDGIFYWFEHEEGAHRMHIADHASGYTSGNDPDVRFAAGST
DRNHITRFETRLAYTPGVHAGGDWNFETPGQVPGGDAPSLVSLPRNGNYEMYEYPAVSGYGTGTRASEGI
ADAEVARLSRLRMQAMEMTHKQIDGGSNVRTLAAGRKFTPYDVANQDNVMGEYVTHMIEHAVVDTSYESV
ENQPEYLNRFVALPSDLPATPGRTVPRPRIDGAQVAIVAGPEGEEIHPDEYGRIKVWFPWDRRASKDGSD
TCWLRVMQNWAGGGWGGQVIPRIGMEVMVSYLEGDPDRPVVTGIVPNPRQRVPYDLPINKTRSTFRTNTH
KGAGFNELRFEDERGIEEIFMHAQRDRNTIVNFDDSSIVRGNALSKTFGEKVTATNGSSREQIGGSSEMH
VMGNMSLNVGPKGHNRRLVEAGRFGDHGYRDGSRRDFNTFKREMRPGLGSGNNGSFQINTQGAFNVDADR
DMDLYTAQRFDLNAKEGCELSTEANIHLASERSTSISSGDSVTIRATRELVLMCGQARIVLHSDGRIALD
GSFISTVASGTVRTNANGNIEENARARFIITGNDVDIN
 
Nucleotide Sequence: 2217 bp     [Download]
>gi|89052491|ref|NC_007802.1|:c3040627-3038411 Jannaschia sp. CCS1 chromosome, complete genome
ATGAACGCAGAAGCTGATTTCATCCAGGCGGATCGCATTTTGCGGGTGGAAACCCCTTTGGGCGATGATG
TCCTGCTGGCTGAAAAACTTGATTTGCGTGAAGTGATCTCGGGGTTTTTTGAAGGGACCTTGGTGGCGCG
GTCCAAGTCGCGCGATCTTGCCCCCGGTGATCTGCTTGGCAGTCTGGTGGATGTCTCCGTTGAACTGGGT
GGCGGAGAACGGCGGTCCTGGAATGCGCTGGTGATGGGGATGACCGCCGGGCCAAAGGCGACGCGCGGTC
TTCAGAGCTACACTCTGATGTTGCGCCCGGAAGCCTGGCTTCTGACTCAAACCTCCGATTGCCGGATCTG
GCTGGACAAATCCTCCGTCGACGTGGCCGAGGCGCTGCTTGGCGAACACGGCATTACCGCGCCGGTGATA
GGTGGCATTACCAGCCCGCCGCCGCCCAAGCATTACTCCGTTCAGTATAACGAGACGGACTGGGCGTATC
TGGTGCGCCGTCTGGAAGAGGATGGCATCTTTTATTGGTTCGAGCATGAAGAGGGCGCGCATAGAATGCA
TATCGCCGATCATGCTTCGGGCTACACCAGCGGGAATGACCCGGACGTGCGCTTCGCCGCAGGGTCCACC
GACCGGAACCACATCACCCGGTTCGAGACGCGGCTGGCCTACACCCCCGGCGTCCACGCTGGCGGTGATT
GGAACTTCGAGACCCCCGGCCAGGTCCCCGGTGGCGATGCACCGAGCCTTGTGTCACTGCCGCGCAACGG
CAACTACGAGATGTATGAATATCCTGCCGTGTCAGGCTATGGCACCGGCACCCGCGCGTCTGAGGGGATC
GCGGACGCCGAGGTCGCGCGGCTGTCACGGTTGCGGATGCAGGCGATGGAGATGACCCATAAACAGATCG
ATGGGGGTAGCAACGTCCGGACCCTCGCAGCGGGTCGCAAGTTTACTCCCTACGACGTGGCGAACCAGGA
CAATGTCATGGGCGAGTATGTCACCCACATGATCGAACACGCCGTCGTGGATACCAGCTACGAGAGCGTG
GAAAACCAGCCCGAATACCTCAACCGCTTCGTGGCGCTGCCCTCGGACCTGCCCGCCACGCCGGGGCGCA
CCGTGCCGCGCCCGCGCATTGATGGCGCGCAGGTGGCCATCGTCGCGGGCCCGGAGGGGGAGGAGATACA
CCCCGACGAATACGGTCGTATCAAGGTCTGGTTCCCCTGGGATCGGCGTGCGTCCAAGGACGGATCCGAT
ACCTGTTGGCTACGGGTCATGCAGAATTGGGCCGGGGGCGGTTGGGGCGGCCAGGTCATTCCGCGTATCG
GGATGGAAGTGATGGTCAGCTATCTGGAAGGGGATCCTGACAGGCCCGTTGTGACCGGGATCGTACCCAA
CCCAAGGCAGCGCGTTCCCTACGACCTGCCAATCAACAAGACCCGCAGTACATTCCGCACGAATACCCAC
AAAGGTGCCGGATTTAATGAATTGCGGTTCGAGGATGAGCGCGGAATTGAAGAGATCTTCATGCATGCGC
AGCGTGACAGAAACACGATCGTTAACTTTGATGATTCCTCGATCGTGCGTGGAAATGCGCTGTCCAAGAC
GTTCGGGGAAAAAGTGACGGCCACCAATGGCTCGTCCCGTGAGCAGATCGGAGGCTCCTCGGAAATGCAC
GTGATGGGCAATATGAGCCTTAACGTTGGACCGAAAGGACATAACCGGCGATTGGTAGAGGCGGGTCGTT
TCGGTGATCACGGGTATCGCGATGGATCGCGCAGAGATTTCAATACTTTCAAGCGGGAGATGCGGCCGGG
TCTTGGGTCGGGCAACAACGGCTCGTTCCAGATCAACACCCAAGGCGCGTTCAACGTTGATGCGGACCGC
GACATGGATCTTTATACCGCACAAAGGTTCGACCTGAATGCCAAGGAAGGGTGCGAACTGAGCACCGAGG
CGAACATTCACCTCGCATCTGAGCGGTCAACGTCTATTTCGAGCGGGGATTCCGTGACCATCAGGGCGAC
GCGTGAGCTTGTGCTGATGTGCGGTCAGGCTCGCATCGTCCTGCATTCCGACGGTAGGATTGCCCTTGAC
GGGTCATTCATAAGTACGGTTGCCAGCGGCACTGTCCGAACCAATGCAAATGGCAATATTGAAGAGAACG
CCCGCGCGCGTTTCATTATCACCGGCAACGATGTGGATATCAATTGA