SecReT6
Protein ID: 89055513
SecReT6 ID118
T6SS typei5
Gene symbol-
Locus tagJann_3022
StrainJannaschia sp. CCS1
Repliconchromosome [GenBank: NC_007802] [Browse all T6SS(s) in this replicon]
Location [Strand]3041821..3042297 [-]
Producthypothetical protein
NoteTssD
UniProt IDQ28MX3
KEGG IDjan:Jann_3022
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 9.70E-32, Aligned region: 4..133
Protein Sequence: 158 a.a.     [Download]
>gi|89055513|ref|YP_510964.1| unnamed protein product [Jannaschia sp. CCS1]
MPIYMQLDGIPGDATHETHRNWMDIETLHWNVSRNMNTQAGSTANREASEPTVSEVVLTKVTDSSSTRLF
AEACTGRTGKLVTIHLVTTGNPGDTYVEYKLTNTLVSNYSVDTSGDRPVETIRLNFTRMEVKYIPHDENH
APQSPMIASYDLTTTRAA
 
Nucleotide Sequence: 477 bp     [Download]
>gi|89052491|ref|NC_007802.1|:c3042297-3041821 Jannaschia sp. CCS1 chromosome, complete genome
ATGCCTATCTACATGCAACTTGACGGAATTCCTGGCGATGCAACCCATGAGACGCACCGCAACTGGATGG
ACATCGAAACGCTGCACTGGAACGTGTCGCGCAACATGAACACCCAGGCCGGGTCGACCGCCAACCGTGA
GGCAAGCGAGCCAACCGTGTCCGAGGTTGTTTTGACCAAAGTGACCGACAGCTCGTCCACCCGTCTGTTC
GCCGAAGCCTGCACGGGCCGCACCGGCAAGCTGGTGACGATCCATCTGGTGACAACGGGCAACCCTGGCG
ACACCTATGTGGAATACAAGCTGACCAACACGCTGGTGTCGAATTACTCCGTCGATACGTCGGGCGACCG
TCCGGTGGAGACCATCCGCCTGAACTTCACCCGCATGGAAGTGAAGTACATCCCACACGATGAGAACCAC
GCACCGCAATCGCCGATGATCGCCTCCTACGATCTGACGACAACGCGCGCGGCCTAA