SecReT6
Protein ID: 89055514
SecReT6 ID118
T6SS typei5
Gene symbol-
Locus tagJann_3023
StrainJannaschia sp. CCS1
Repliconchromosome [GenBank: NC_007802] [Browse all T6SS(s) in this replicon]
Location [Strand]3042365..3044959 [-]
ProductATPase
NoteTssH
UniProt IDQ28MX2
KEGG IDjan:Jann_3023
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.00E-38, Aligned region: 215..251
AAA_2 [PF07724], Evalue: 2.00E-38, Aligned region: 587..754
AAA [PF00004], Evalue: 6.50E-19, Aligned region: 216..328
AAA [PF00004], Evalue: 6.50E-19, Aligned region: 593..711
ClpB_D2-small [PF10431], Evalue: 1.40E-12, Aligned region: 466..504
ClpB_D2-small [PF10431], Evalue: 1.40E-12, Aligned region: 760..831
AAA_5 [PF07728], Evalue: 5.20E-12, Aligned region: 216..234
AAA_5 [PF07728], Evalue: 5.20E-12, Aligned region: 314..346
AAA_5 [PF07728], Evalue: 5.20E-12, Aligned region: 592..712
AAA_16 [PF13191], Evalue: 4.00E-11, Aligned region: 192..236
AAA_16 [PF13191], Evalue: 4.00E-11, Aligned region: 260..294
AAA_16 [PF13191], Evalue: 4.00E-11, Aligned region: 562..623
AAA_16 [PF13191], Evalue: 4.00E-11, Aligned region: 657..685
AAA_22 [PF13401], Evalue: 3.10E-08, Aligned region: 216..297
AAA_22 [PF13401], Evalue: 3.10E-08, Aligned region: 589..615
AAA_22 [PF13401], Evalue: 3.10E-08, Aligned region: 654..673
Sigma54_activat [PF00158], Evalue: 2.10E-07, Aligned region: 199..234
Sigma54_activat [PF00158], Evalue: 2.10E-07, Aligned region: 574..697
Sigma54_activat [PF00158], Evalue: 2.10E-07, Aligned region: 729..750
Clp_N [PF02861], Evalue: 2.00E-06, Aligned region: 24..71
AAA_25 [PF13481], Evalue: 3.70E-06, Aligned region: 199..243
AAA_25 [PF13481], Evalue: 3.70E-06, Aligned region: 398..418
AAA_25 [PF13481], Evalue: 3.70E-06, Aligned region: 571..619
IstB_IS21 [PF01695], Evalue: 1.10E-05, Aligned region: 209..238
IstB_IS21 [PF01695], Evalue: 1.10E-05, Aligned region: 591..615
AAA_19 [PF13245], Evalue: 1.20E-05, Aligned region: 213..237
AAA_19 [PF13245], Evalue: 1.20E-05, Aligned region: 400..420
AAA_19 [PF13245], Evalue: 1.20E-05, Aligned region: 585..614
AAA_17 [PF13207], Evalue: 7.50E-05, Aligned region: 181..210
AAA_17 [PF13207], Evalue: 7.50E-05, Aligned region: 219..235
AAA_17 [PF13207], Evalue: 7.50E-05, Aligned region: 591..627
NACHT [PF05729], Evalue: 8.60E-05, Aligned region: 216..248
NACHT [PF05729], Evalue: 8.60E-05, Aligned region: 592..633
AAA_18 [PF13238], Evalue: 0.0005, Aligned region: 217..236
AAA_18 [PF13238], Evalue: 0.0005, Aligned region: 593..623
Zeta_toxin [PF06414], Evalue: 0.00086, Aligned region: 216..234
Zeta_toxin [PF06414], Evalue: 0.00086, Aligned region: 589..632
AAA_29 [PF13555], Evalue: 0.00095, Aligned region: 208..233
AAA_29 [PF13555], Evalue: 0.00095, Aligned region: 588..604
Arch_ATPase [PF01637], Evalue: 0.0012, Aligned region: 194..231
Arch_ATPase [PF01637], Evalue: 0.0012, Aligned region: 268..366
Arch_ATPase [PF01637], Evalue: 0.0012, Aligned region: 586..630
AAA_14 [PF13173], Evalue: 0.0069, Aligned region: 216..345
AAA_14 [PF13173], Evalue: 0.0069, Aligned region: 590..673
DUF258 [PF03193], Evalue: 0.0085, Aligned region: 212..234
DUF258 [PF03193], Evalue: 0.0085, Aligned region: 591..606
Protein Sequence: 864 a.a.     [Download]
>gi|89055514|ref|YP_510965.1| unnamed protein product [Jannaschia sp. CCS1]
MSHIDLHVLISRLAPGLAAALEGAAALAVRFGHSSIDLEHWLVGICDTDAAARLTEAGVNPADVRAQALR
AVEAHRRGDAQTPSIARPVVDLAREAWSLASLRYDRGRISVDVLFLTLCDDTSLRAHMRRVAPALLKLDT
AVLEEGVLADVATAPAPSDAMSATNKPVGGEDFLALYAHDLTAQARDGQIDRIVGRDAELRQMVDVLLRR
RQNNPILLGEAGVGKTAVVEALALQIVDGQVPGSLKDVTLYALDLNLLQAGAGVKGEFERRLTGVLDQVK
AADSPVILFIDEAHGMIGAGGQAGQGDAANILKPALARGEFRTIAATTWSEYKKYFEKDAALTRRFQPVK
VAEPDIETAVRMLRAVSSRFEDHHGVSIRESAVRAAVELSARYLPERQLPDKAVSVIDTAAAAVRLSRDV
TPDALARHRTEAAHLEAEIARLEAEPPAPDHAARLKSLRAERDAAEDAAKVLDDALTEQLGLAEAADAIA
AENDEDALIRLADAEAALGRAGGENPLVHRVVDAEAVAQVIGRWTGVPTGRLMRSQIAAAASLAERMKAR
VLGQDAAIDTIAEAMRVARANLGDARRPQGVFLLVGTSGVGKTETALALADELYGGQHALSVINMTEFKE
EHKVSLLMGSPPGYVGYGEGGVLTEAVRRRPFGVLLLDEIDKAHPGVQDIFYQVFDKGILRDGEGRDVDF
RNTTILMTANTGTDTLATLAEDPETMPDAAALPDLLKSELLAQFKPAFLGRLAVVPYLPLDTDTMAGIVD
LQVARIADRLDANYGARLEVSEAARTHLTTRAQSSDAGARAIETMLSQKVLPRMADFILDSVADGMMPRA
IGLDVADSGEIQIATIGKRRRLAS
 
Nucleotide Sequence: 2595 bp     [Download]
>gi|89052491|ref|NC_007802.1|:c3044959-3042365 Jannaschia sp. CCS1 chromosome, complete genome
ATGTCTCATATTGATTTGCACGTTCTCATATCGCGCCTCGCGCCGGGCCTTGCGGCTGCGTTGGAAGGGG
CGGCAGCGCTGGCAGTGCGGTTTGGGCATAGCAGCATCGATCTTGAACACTGGCTCGTCGGAATTTGCGA
TACCGACGCCGCCGCGCGGCTGACTGAGGCGGGTGTGAATCCCGCCGATGTCCGGGCTCAGGCCCTGCGC
GCTGTTGAGGCGCACCGGCGCGGCGATGCGCAAACTCCCTCCATCGCGCGGCCCGTCGTGGACCTGGCGC
GCGAAGCGTGGAGCCTGGCGAGCCTGCGGTACGATCGGGGGCGTATCTCCGTCGACGTGCTGTTCCTGAC
GCTGTGCGATGATACCTCGCTGCGCGCCCATATGCGCCGTGTTGCCCCCGCATTGCTGAAGCTCGACACG
GCGGTTCTGGAGGAGGGCGTGCTTGCCGACGTCGCAACTGCTCCGGCCCCTTCAGACGCGATGTCCGCAA
CCAACAAGCCCGTCGGCGGAGAAGATTTTCTGGCGCTCTATGCCCATGATTTGACGGCTCAGGCGCGGGA
CGGCCAGATTGACCGTATCGTCGGGCGCGACGCCGAACTGCGGCAGATGGTTGATGTCCTATTGCGCCGC
CGCCAGAACAATCCGATCCTGTTGGGCGAGGCCGGTGTTGGCAAAACGGCTGTGGTCGAAGCGCTGGCGC
TTCAGATTGTCGACGGGCAGGTGCCGGGCAGCCTGAAAGACGTGACGCTCTACGCGCTGGACCTGAACCT
GTTGCAGGCGGGTGCTGGCGTGAAGGGTGAATTTGAACGGCGTCTGACCGGCGTGCTGGATCAGGTGAAA
GCCGCCGATAGCCCGGTGATTCTGTTCATCGACGAGGCCCACGGAATGATCGGTGCCGGTGGTCAGGCAG
GGCAGGGGGATGCGGCCAATATCCTCAAGCCTGCCTTGGCGCGGGGCGAGTTCCGCACCATCGCCGCGAC
GACCTGGAGCGAGTACAAGAAATATTTCGAGAAGGACGCGGCCCTGACCCGGCGCTTCCAGCCCGTCAAA
GTGGCTGAGCCTGATATTGAAACGGCTGTGCGGATGCTGCGCGCCGTGTCGAGCCGGTTTGAAGATCACC
ATGGCGTCTCAATTCGGGAAAGCGCCGTGCGCGCCGCCGTGGAGTTGAGCGCGCGGTATCTGCCCGAGCG
ACAGCTGCCGGACAAGGCGGTCAGCGTGATTGATACCGCCGCCGCCGCCGTGCGGTTGAGCCGGGATGTG
ACGCCGGACGCGCTGGCCCGGCACCGCACTGAGGCCGCCCATCTGGAAGCGGAGATTGCCCGGTTGGAGG
CCGAACCGCCTGCACCGGACCATGCTGCGCGCCTCAAGTCCCTGCGCGCCGAACGCGATGCTGCGGAAGA
TGCGGCAAAGGTGCTGGACGACGCGCTGACCGAGCAGCTTGGCCTGGCCGAAGCCGCTGACGCCATCGCC
GCCGAAAATGACGAGGACGCCCTGATCCGTCTGGCCGATGCGGAAGCCGCTTTGGGGCGTGCCGGGGGCG
AAAACCCGCTGGTCCACCGCGTTGTCGATGCCGAGGCCGTCGCGCAAGTGATCGGGCGTTGGACGGGCGT
GCCCACGGGTCGTCTGATGCGCAGCCAGATCGCTGCCGCAGCCTCATTGGCCGAACGGATGAAGGCCCGC
GTTCTGGGTCAGGACGCGGCGATTGACACGATAGCCGAGGCGATGCGCGTGGCCCGCGCCAACCTTGGGG
ATGCGCGCCGTCCACAGGGCGTGTTCCTGCTGGTGGGCACATCCGGCGTGGGCAAGACGGAAACGGCGCT
CGCGCTGGCAGATGAGCTCTATGGCGGCCAGCACGCGCTGAGCGTCATCAACATGACTGAGTTCAAGGAA
GAACATAAAGTGAGCCTGCTGATGGGCTCGCCCCCCGGCTATGTGGGCTACGGCGAGGGCGGCGTGTTGA
CCGAGGCCGTGCGACGCAGGCCATTTGGCGTCCTGCTGCTGGATGAAATCGACAAGGCGCATCCGGGTGT
GCAGGACATTTTCTATCAGGTGTTTGACAAGGGCATTCTGCGCGACGGCGAAGGCCGCGACGTGGATTTC
CGCAACACCACGATCCTGATGACGGCCAACACCGGCACGGACACACTGGCGACGCTCGCCGAAGATCCCG
AAACCATGCCGGATGCCGCCGCGCTGCCGGATCTGCTGAAGTCCGAGCTTCTGGCGCAGTTCAAACCCGC
GTTTCTGGGGCGGCTGGCGGTGGTGCCATATCTGCCACTGGATACCGACACGATGGCGGGGATCGTTGAC
CTGCAAGTGGCGCGGATCGCCGACCGGCTCGATGCTAACTACGGGGCGCGACTGGAGGTCAGCGAGGCCG
CCCGCACCCACCTGACGACCCGTGCGCAATCCAGCGATGCCGGTGCGCGCGCGATAGAGACCATGCTGTC
ACAAAAGGTTCTTCCTCGCATGGCTGACTTCATTCTGGATTCGGTGGCCGACGGCATGATGCCGCGCGCC
ATCGGCCTTGACGTCGCTGACAGTGGTGAAATCCAGATCGCCACCATCGGAAAAAGGCGACGTCTTGCGA
GCTGA