SecReT6
Protein ID: 89055515
SecReT6 ID118
T6SS typei5
Gene symbol-
Locus tagJann_3024
StrainJannaschia sp. CCS1
Repliconchromosome [GenBank: NC_007802] [Browse all T6SS(s) in this replicon]
Location [Strand]3045161..3046240 [+]
Producthypothetical protein
NoteTssA
UniProt IDQ28MX1
KEGG IDjan:Jann_3024
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.30E-18, Aligned region: 72..133
Amidohydro_4 [PF13147], Evalue: 0.00025, Aligned region: 50..114
Amidohydro_4 [PF13147], Evalue: 0.00025, Aligned region: 148..274
Protein Sequence: 359 a.a.     [Download]
>gi|89055515|ref|YP_510966.1| unnamed protein product [Jannaschia sp. CCS1]
MSSSDNWRERISVPDASHTANNDGSVGENPRETDRAIAEYRRLRDARSAARAEERKQETAEARDRALKVA
PDWTIVRDLARFLLDEVGRDIEVAVWLIEAETRLDGFDGLARAAEQLADMINAHGMALHPQPEDALDRPF
DMIAGLNGIGREGTLIQPLRLVPLVAEGDYGQQGLWNVTDGGGAASVAAALATSGTEQISHHLNGVDRAR
RAVARCDTALTALLGPDAPPFNKIDESLEDAAAAIRNLAGHLLTSEPDENTADATGLGEDPPTTSATTQV
MGKISSRDEAFAQMLRIAAYFRKTEPHSPIADTLETLVRRGRMDFVTLLTELIPDDHARQAVMTTAGIGS
KPPTSETEG
 
Nucleotide Sequence: 1080 bp     [Download]
>gi|89052491|ref|NC_007802.1|:3045161-3046240 Jannaschia sp. CCS1 chromosome, complete genome
ATGAGTTCTAGTGATAATTGGCGAGAAAGAATTTCCGTGCCGGATGCGTCTCATACTGCGAATAACGACG
GAAGTGTCGGCGAAAATCCGCGCGAAACGGATCGGGCAATTGCGGAATACCGCCGACTGCGCGACGCCCG
CTCGGCCGCCCGCGCCGAGGAGCGGAAACAGGAAACGGCGGAGGCCCGTGATCGGGCCCTGAAGGTCGCC
CCGGATTGGACCATTGTGCGCGATCTGGCCCGGTTCCTGCTTGACGAAGTCGGGCGCGATATCGAGGTCG
CTGTTTGGTTGATCGAAGCCGAGACGCGGCTGGACGGCTTCGACGGGCTGGCCCGCGCGGCAGAGCAATT
GGCCGACATGATTAACGCCCATGGCATGGCGCTTCACCCGCAACCCGAAGACGCTTTAGATCGGCCGTTT
GACATGATTGCCGGTCTCAATGGGATCGGTCGAGAGGGCACTTTGATCCAACCGCTTCGGCTTGTACCAC
TGGTGGCCGAGGGCGATTATGGTCAACAGGGGTTGTGGAATGTCACCGACGGCGGCGGCGCAGCGAGCGT
TGCAGCAGCCTTGGCCACCAGTGGTACAGAGCAGATTTCCCACCACTTAAACGGTGTGGACCGCGCGCGC
CGCGCAGTCGCCCGTTGCGATACCGCCCTGACCGCGCTTCTGGGGCCGGACGCACCGCCGTTCAACAAAA
TTGACGAAAGCCTGGAAGACGCAGCCGCCGCGATCCGCAACCTTGCGGGCCATCTTTTGACGTCGGAACC
CGACGAGAATACCGCCGATGCGACAGGTCTCGGCGAGGATCCGCCCACCACCTCTGCCACGACGCAAGTA
ATGGGTAAAATTTCATCGCGGGACGAGGCCTTCGCACAAATGTTACGCATTGCTGCTTATTTCCGCAAAA
CCGAACCCCATTCTCCAATCGCCGATACGCTTGAAACATTGGTTCGGCGTGGACGTATGGATTTTGTGAC
TTTGCTGACGGAATTGATACCGGACGATCACGCCCGCCAGGCGGTAATGACCACCGCAGGAATAGGTTCA
AAACCTCCCACCTCCGAGACAGAGGGCTGA