SecReT6
Protein ID: 89055516
SecReT6 ID118
T6SS typei5
Gene symbol-
Locus tagJann_3025
StrainJannaschia sp. CCS1
Repliconchromosome [GenBank: NC_007802] [Browse all T6SS(s) in this replicon]
Location [Strand]3046392..3046895 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ28MX0
KEGG IDjan:Jann_3025
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.00E-60, Aligned region: 8..163
Protein Sequence: 167 a.a.     [Download]
>gi|89055516|ref|YP_510967.1| unnamed protein product [Jannaschia sp. CCS1]
MASIHDKLDKVRKPRVHIKYEVETEGAMVQKELPFVVGVLGDFSGDPTEDLKPFGDRKFVQIDKDNFNEV
MARMTPGLNFRVENTLSDEDDEMKVQLAFNSLDDFEPAQVVDQVPALKKLLESRNQLRDLLSKADRSEEL
ETLLEKMLQDDAALKDIVDQLKAEGEK
 
Nucleotide Sequence: 504 bp     [Download]
>gi|89052491|ref|NC_007802.1|:3046392-3046895 Jannaschia sp. CCS1 chromosome, complete genome
ATGGCGAGCATTCATGACAAACTGGATAAAGTGCGCAAACCGCGTGTCCACATCAAGTATGAGGTCGAGA
CCGAAGGCGCGATGGTCCAGAAGGAACTTCCCTTCGTGGTGGGCGTCCTTGGCGACTTCTCCGGCGATCC
CACCGAGGATCTGAAACCCTTCGGTGACCGCAAGTTCGTGCAGATCGACAAGGATAATTTCAATGAGGTC
ATGGCCCGCATGACGCCGGGCCTGAACTTCCGCGTCGAGAACACGCTGTCGGACGAGGATGATGAAATGA
AGGTCCAGCTGGCCTTCAACTCCCTCGATGATTTCGAGCCTGCGCAGGTCGTGGATCAGGTGCCCGCACT
GAAGAAGCTTCTGGAGAGCCGCAATCAGTTGCGCGACCTGCTCAGCAAGGCCGACCGTTCGGAAGAGTTG
GAGACGCTGCTAGAGAAAATGTTGCAGGATGATGCCGCGCTGAAAGACATAGTCGACCAGCTCAAAGCCG
AAGGGGAGAAGTGA