SecReT6
Protein ID: 89055517
SecReT6 ID118
T6SS typei5
Gene symbol-
Locus tagJann_3026
StrainJannaschia sp. CCS1
Repliconchromosome [GenBank: NC_007802] [Browse all T6SS(s) in this replicon]
Location [Strand]3046898..3048382 [+]
Producthypothetical protein
NoteTssC
UniProt IDQ28MW9
KEGG IDjan:Jann_3026
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 7.50E-190, Aligned region: 65..491
Protein Sequence: 494 a.a.     [Download]
>gi|89055517|ref|YP_510968.1| unnamed protein product [Jannaschia sp. CCS1]
MATDAQTNPATQTTTEDQGTSLLSDVIGATRQTEPDRTKELIRTLTDAALDGTVSYNRNLTITLTKAIEA
LDSRISEQLAAIMQAPEFAALEGSWRGLWHLVQNSNTSANLKIRVLNASKKEIGRDLAKAVEFDQSRLFK
AIYEDEFGTPGGEPMGALIGDFEFDNSFEDVECLQGISQVSAAAFAPFISAASPRLFGFDDYTELSKPRD
LSKTFDASEYAKWRSFRNSEESRFVTLTMPRVLARVPYGPNTRTIDEFDYDEAIAYAGERIPHDNYCWMN
ASYALATNLTEAFNQTGWCTAIRGAENGGKVEGLPMHLFSTDEGDVDIKCPTEIAITDRRDAELGAMGFL
PLCYYKNHDYAVFFGAQTAHKPAKYDKPEATANAAISARLPYMMATSRFAHYLKVIGRDKIGSFMEAEDC
EDWLNRWISNYVNANDAAGPDMRAQYPLRDAKVSVEEIPGKPGSYNAVAWLRPWLQMEELTTSLRMVARI
PEKQ
 
Nucleotide Sequence: 1485 bp     [Download]
>gi|89052491|ref|NC_007802.1|:3046898-3048382 Jannaschia sp. CCS1 chromosome, complete genome
ATGGCGACTGACGCGCAAACCAATCCCGCCACGCAGACAACGACCGAGGATCAGGGCACATCGTTGCTGT
CCGATGTGATCGGTGCCACCCGCCAGACCGAGCCGGACCGCACGAAAGAGCTGATCCGCACCCTCACCGA
TGCCGCCCTCGACGGCACGGTCAGCTACAACCGCAATCTGACGATCACGCTGACCAAGGCGATTGAGGCT
CTGGACAGCCGCATTTCCGAGCAGTTGGCGGCGATCATGCAGGCCCCTGAATTTGCCGCCCTGGAAGGAT
CCTGGCGCGGGCTTTGGCATCTGGTGCAGAACTCCAACACCTCCGCCAATCTGAAGATCCGGGTGCTCAA
CGCCTCCAAGAAAGAGATCGGGCGCGACTTGGCCAAGGCCGTTGAATTCGACCAATCCCGGCTGTTCAAG
GCGATCTATGAGGACGAGTTCGGCACCCCGGGCGGGGAGCCCATGGGCGCGCTGATCGGCGATTTTGAGT
TCGACAACAGCTTTGAAGACGTCGAATGTCTGCAAGGCATCAGCCAGGTGTCGGCCGCAGCCTTCGCGCC
TTTCATCTCTGCCGCCTCGCCAAGGCTCTTCGGGTTCGACGATTACACCGAATTGTCCAAACCGCGCGAT
CTGTCCAAGACTTTTGACGCGTCAGAATATGCCAAGTGGCGCAGCTTCCGCAATTCCGAGGAAAGCCGCT
TCGTCACCCTGACGATGCCCCGCGTACTGGCGCGCGTGCCCTACGGCCCCAACACCCGCACCATCGATGA
GTTCGATTACGATGAGGCCATCGCCTATGCGGGCGAGCGCATCCCGCACGATAATTACTGCTGGATGAAC
GCCTCCTACGCGCTGGCGACCAATCTTACGGAAGCGTTCAACCAGACCGGTTGGTGCACCGCCATTCGCG
GCGCGGAAAACGGCGGCAAAGTCGAAGGGCTGCCGATGCACCTCTTCTCCACCGACGAGGGCGACGTAGA
CATCAAGTGCCCCACGGAGATCGCCATCACCGACCGGCGCGATGCGGAGCTTGGGGCCATGGGGTTTCTG
CCGCTTTGCTATTACAAGAACCACGACTACGCCGTGTTCTTTGGCGCGCAAACGGCCCACAAACCGGCCA
AGTACGACAAGCCGGAAGCCACGGCCAATGCGGCGATTTCCGCCCGCCTGCCCTACATGATGGCCACGTC
GCGGTTCGCCCATTACCTCAAGGTGATCGGCCGCGACAAGATCGGCTCGTTCATGGAGGCGGAGGATTGC
GAAGACTGGCTGAACCGTTGGATCAGCAACTACGTCAATGCCAATGACGCGGCGGGGCCGGACATGCGGG
CGCAATATCCGCTACGCGATGCCAAGGTCTCGGTGGAGGAGATCCCCGGAAAGCCGGGCAGCTACAACGC
CGTGGCCTGGCTGAGGCCCTGGTTGCAGATGGAAGAGCTGACGACGTCCTTGCGGATGGTGGCCCGTATC
CCCGAGAAGCAGTGA