SecReT6
Protein ID: 89055518
SecReT6 ID118
T6SS typei5
Gene symbol-
Locus tagJann_3027
StrainJannaschia sp. CCS1
Repliconchromosome [GenBank: NC_007802] [Browse all T6SS(s) in this replicon]
Location [Strand]3048384..3049781 [+]
Producthypothetical protein
NoteTssC
UniProt IDQ28MW8
KEGG IDjan:Jann_3027
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 5.70E-141, Aligned region: 26..456
Protein Sequence: 465 a.a.     [Download]
>gi|89055518|ref|YP_510969.1| unnamed protein product [Jannaschia sp. CCS1]
MTAPMPNLGAVFDTVDPAMAHLAARIDRLILAIDAALTRQLNAILAASEFRALEARWRALDRVLTHAGRD
GQVIVRILNVSWRALSRDLDRAVEFDQSHLHKLVYDGEFGMPGGLPFGVLVADYEVSATTDRARGDQVET
LSRLAAVAAAAFCPIMLGAAPDLLGVDDFDQIAPYTDLTDAEGRRADPPMIRWRALRDRDDARFIGLVAP
RIVLRGPRTRLSPTRADGFTFDEDPHRILSVAGSFAFATTVIAAFRASGWFAAIRGAAQDTDGGGRVAGW
PGHDLGTDGHNLSRQSPATLRLTAAQEDALIARGIVPLSSLPLTDEAVFNANPSLHRPTRYDSPVASENA
RISAMLQYVLCTSRFAHYLKVMMREAIGSVAPPDVIQGHLDDWLRGYCLGNEDAGAELKAEYPLRNAGVE
VTPIPGKPGAFAARIHLQPHFQLDDISTSFHLVSEAPAGLERTSA
 
Nucleotide Sequence: 1398 bp     [Download]
>gi|89052491|ref|NC_007802.1|:3048384-3049781 Jannaschia sp. CCS1 chromosome, complete genome
ATGACAGCCCCGATGCCAAACCTCGGGGCGGTGTTCGATACGGTCGATCCGGCGATGGCGCATCTGGCCG
CCCGGATCGACCGCCTGATCTTGGCGATTGATGCGGCCCTGACACGACAGCTGAACGCGATTCTCGCCGC
GTCCGAGTTTCGGGCGTTAGAGGCGCGTTGGCGCGCGCTTGACCGTGTGCTGACCCATGCGGGGCGTGAT
GGACAGGTGATTGTGCGGATCCTCAACGTGTCATGGCGGGCCCTGTCCCGGGATCTGGACCGGGCGGTGG
AGTTTGATCAGTCGCACCTGCACAAGTTGGTCTATGACGGTGAATTCGGGATGCCGGGCGGTTTGCCCTT
TGGCGTTCTGGTTGCCGATTACGAGGTCTCGGCCACCACCGACCGCGCGCGCGGCGATCAGGTAGAGACT
CTTTCGCGGCTGGCCGCAGTGGCGGCTGCCGCGTTTTGTCCAATTATGCTCGGCGCCGCGCCGGACCTTC
TGGGCGTGGACGACTTCGACCAGATCGCGCCCTACACGGATTTGACGGATGCTGAGGGACGCCGTGCTGA
TCCGCCGATGATCCGGTGGCGCGCGCTCCGGGATCGTGACGACGCCCGGTTCATTGGCCTCGTCGCGCCA
CGCATCGTTCTGCGCGGGCCCCGGACGCGGCTGTCGCCCACCCGCGCCGACGGGTTCACCTTTGACGAAG
ATCCGCACCGCATCCTGAGCGTCGCGGGCAGTTTTGCTTTTGCCACCACAGTGATCGCAGCCTTTCGCGC
TTCTGGCTGGTTCGCCGCGATCCGGGGGGCTGCGCAGGACACGGATGGCGGCGGGCGTGTGGCGGGCTGG
CCGGGCCATGACCTTGGCACCGATGGCCACAATCTCTCGCGCCAATCCCCCGCCACCCTGCGCCTCACCG
CCGCCCAGGAAGACGCGCTGATCGCACGTGGGATCGTGCCGTTGTCCTCCCTGCCCCTCACGGATGAGGC
GGTCTTCAACGCCAACCCCTCGCTGCATCGGCCCACCCGCTATGACAGCCCCGTCGCGTCCGAAAACGCG
CGGATCTCGGCCATGTTGCAATATGTTCTGTGCACCTCGCGCTTTGCCCATTACCTCAAGGTGATGATGC
GCGAGGCCATCGGCTCCGTCGCGCCACCTGATGTGATTCAGGGGCATCTGGATGATTGGCTGCGCGGATA
CTGCCTTGGCAATGAGGACGCGGGCGCAGAGCTGAAGGCCGAATATCCCCTGCGCAATGCGGGCGTGGAG
GTCACGCCGATCCCCGGCAAGCCCGGTGCCTTTGCCGCGCGGATACACCTGCAGCCGCATTTCCAACTCG
ATGACATATCGACCAGTTTCCACCTTGTCTCCGAGGCCCCGGCGGGCTTGGAAAGGACCTCTGCGTGA