SecReT6
Protein ID: 89055519
SecReT6 ID118
T6SS typei5
Gene symbol-
Locus tagJann_3028
StrainJannaschia sp. CCS1
Repliconchromosome [GenBank: NC_007802] [Browse all T6SS(s) in this replicon]
Location [Strand]3049778..3050575 [+]
Productvirulence protein, SciE type
NoteTagJ
UniProt IDQ28MW7
KEGG IDjan:Jann_3028
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 6.20E-33, Aligned region: 142..262
TPR_16 [PF13432], Evalue: 0.0021, Aligned region: 15..63
TPR_16 [PF13432], Evalue: 0.0021, Aligned region: 88..98
Protein Sequence: 265 a.a.     [Download]
>gi|89055519|ref|YP_510970.1| unnamed protein product [Jannaschia sp. CCS1]
MTTSTDTIASLLSRDALEDARTQSAAAVKAAPQDTDARLTLAQICAIAGDLPRAETHARMAQTLDEARTM
ALAEFRQYLRALEARAQWWDAGAVPDMPGGPTALDQLAMAGHVAHLAGDMDGAVRAATDLEEARPACTGT
IDGTAFDDLRDVDDRLPHALEVLTPGGHYLWLDLSRVARVDLAPVAAPFDLIARPARVALRDGSTADLCL
PAVYDAPRTAQEQLGRVTEFEELAPGLVRGYGQRAWLAGDDLVGLTDPAEITLDE
 
Nucleotide Sequence: 798 bp     [Download]
>gi|89052491|ref|NC_007802.1|:3049778-3050575 Jannaschia sp. CCS1 chromosome, complete genome
GTGACCACTTCCACTGACACGATCGCCTCCCTTCTGTCCCGCGATGCGCTGGAGGACGCGCGGACCCAGT
CCGCCGCCGCCGTCAAGGCCGCCCCACAGGACACCGACGCGCGCCTGACGCTGGCCCAGATCTGCGCCAT
CGCCGGTGACCTGCCCCGCGCTGAAACCCACGCCCGCATGGCCCAGACCCTGGATGAGGCCCGCACCATG
GCGCTGGCGGAATTCCGGCAATACCTGCGCGCATTGGAGGCGCGGGCGCAGTGGTGGGACGCAGGCGCCG
TGCCCGATATGCCCGGCGGGCCGACCGCGCTGGATCAACTGGCGATGGCAGGTCACGTGGCGCATCTGGC
AGGCGACATGGACGGAGCCGTGCGCGCCGCAACCGATCTGGAAGAGGCCCGCCCCGCCTGCACCGGGACA
ATAGATGGCACCGCGTTTGACGATCTGCGCGATGTCGATGACCGCCTGCCCCACGCTTTGGAAGTGCTGA
CGCCGGGGGGTCACTACCTGTGGCTCGACCTTTCCCGCGTGGCGCGCGTCGACCTCGCGCCCGTCGCCGC
GCCGTTTGATCTGATCGCCCGGCCCGCCCGTGTGGCGTTGCGCGACGGCTCCACCGCCGATCTGTGCTTG
CCCGCCGTCTATGACGCACCACGCACTGCGCAGGAACAGCTTGGCCGCGTGACGGAGTTCGAAGAGCTCG
CACCCGGCCTTGTGCGCGGTTACGGCCAACGGGCCTGGCTTGCGGGCGACGATCTGGTGGGTCTCACCGA
TCCGGCGGAGATCACATTAGATGAATAG