SecReT6
Protein ID: 89055520
SecReT6 ID118
T6SS typei5
Gene symbol-
Locus tagJann_3029
StrainJannaschia sp. CCS1
Repliconchromosome [GenBank: NC_007802] [Browse all T6SS(s) in this replicon]
Location [Strand]3050568..3051110 [+]
Producthypothetical protein
NoteTssE
UniProt IDQ28MW6
KEGG IDjan:Jann_3029
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.80E-17, Aligned region: 52..153
Protein Sequence: 180 a.a.     [Download]
>gi|89055520|ref|YP_510971.1| unnamed protein product [Jannaschia sp. CCS1]
MNRDRRLHLGMRDAPRGGDDARLQSALLDRLIDLDPDLTEDPAVTEAETFAGLRAALRRDLEMLLNTRAV
PETPAPGLTELADSALSYGSLDFFSAHLTTDGQRTAFALDLKTRIERFEPRLRDLSVDLVSDPNPSRRKL
RLRIAARHVARPGLPPMVFETAMDPVAGRFTVTDAAGERT
 
Nucleotide Sequence: 543 bp     [Download]
>gi|89052491|ref|NC_007802.1|:3050568-3051110 Jannaschia sp. CCS1 chromosome, complete genome
ATGAATAGGGACCGGCGGCTTCATCTTGGAATGCGGGATGCCCCGCGTGGCGGCGACGATGCCCGCCTGC
AATCGGCGCTGCTTGACCGGTTGATCGATCTGGACCCCGATCTGACTGAGGATCCCGCCGTGACGGAGGC
CGAGACTTTCGCTGGCCTGCGCGCTGCCCTGCGCCGCGATCTGGAGATGTTGCTCAATACCCGCGCCGTG
CCTGAGACGCCCGCCCCGGGCCTGACGGAGCTGGCCGACAGCGCGCTGTCCTACGGCAGCCTCGATTTCT
TCTCCGCCCATCTGACGACCGACGGCCAGCGGACGGCCTTCGCGCTGGATCTCAAGACCCGGATCGAGCG
GTTTGAGCCACGCCTCCGCGATCTCTCCGTTGATCTGGTGTCAGACCCCAACCCCAGCCGCCGCAAGTTG
CGCCTGCGCATTGCCGCGCGCCACGTGGCCCGCCCCGGTCTGCCGCCGATGGTGTTCGAGACGGCGATGG
ATCCCGTCGCCGGGCGCTTCACGGTCACCGATGCTGCGGGAGAGCGCACGTGA