SecReT6
Protein ID: 89055521
SecReT6 ID118
T6SS typei5
Gene symbol-
Locus tagJann_3030
StrainJannaschia sp. CCS1
Repliconchromosome [GenBank: NC_007802] [Browse all T6SS(s) in this replicon]
Location [Strand]3051107..3052885 [+]
Producthypothetical protein
NoteTssF
UniProt IDQ28MW5
KEGG IDjan:Jann_3030
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 4.00E-184, Aligned region: 5..592
Protein Sequence: 592 a.a.     [Download]
>gi|89055521|ref|YP_510972.1| unnamed protein product [Jannaschia sp. CCS1]
MTNRFLEFYNTELAALRHRATRFAEAHPKIAGRLRLASDVADDPNVERLIQSFAYTAARVHQKIDDSLPE
LTDGLLETLYPHYLAPLPSLTILGLSPDRGMDGAQTVPRGTEVTSQVIDGDRVRFTTTQDVPLSPVKLTE
IRLSARPFEAPPAPTAASATCLRLSLAPTGRVSLRDMDLKRLRLFLSGPTTEAQVLAQLMLQSLTGVTMA
AHAGDENARRMPTSALRPIAFDDDTSLIPWPAGSFTGYRTLTEFAALPEKFLFFDLHLDRVVETDRLDLY
LYFDMPPGDVLKSVGAHSVTLHATPAVNLFASQAEPIALDGTRSAYPLAADARRPRTRAVHSVRRVTVAN
GDGTSATSAPIFHRLTDHQRGGTFWHLRRHSEDQGHAPGATSLAFVDARNQPDAPNDSTASIDILTTNAN
LPRKLPFGGGQPALSLASPIDHVSGVTCLRAPTPPRAPGADADRAWQLMSHLSLNHLSLTDSGAPALRDI
LRLYDPGDGPEMAQLIDAIDDVSTRTGLARIDGVTVTGTDITLAFDDSRIAPGQAVVFASVLDRFFGCYT
TLNTFTRLSVRMRDRTDWLAKFAARAGEAALI
 
Nucleotide Sequence: 1779 bp     [Download]
>gi|89052491|ref|NC_007802.1|:3051107-3052885 Jannaschia sp. CCS1 chromosome, complete genome
GTGACCAACCGCTTCCTGGAATTCTACAATACTGAACTGGCCGCCCTGCGCCACCGCGCCACGCGCTTTG
CCGAAGCGCATCCCAAGATCGCCGGGCGGCTGCGTTTGGCCTCCGATGTGGCCGACGACCCGAACGTGGA
GCGTCTGATCCAATCCTTCGCCTATACCGCCGCGCGGGTGCATCAGAAGATCGACGACAGCCTGCCGGAG
CTGACCGACGGCCTGCTGGAAACGCTCTACCCGCACTACCTCGCCCCCCTGCCTTCGCTCACCATCCTTG
GCCTGTCGCCTGATCGCGGCATGGACGGCGCGCAAACGGTGCCCCGCGGGACAGAGGTGACGTCGCAGGT
TATCGACGGGGACCGTGTGCGGTTCACGACGACGCAGGATGTGCCGCTCTCGCCTGTGAAACTGACCGAA
ATTCGCCTCAGCGCGCGCCCGTTCGAGGCCCCGCCTGCCCCTACTGCGGCCTCTGCCACCTGCCTGCGGC
TCAGCCTTGCGCCCACGGGCCGCGTGTCACTCCGCGACATGGACCTGAAGCGTCTGCGTCTGTTTCTGTC
GGGACCGACGACCGAAGCGCAGGTCCTCGCCCAACTGATGCTGCAATCGCTGACCGGCGTCACCATGGCC
GCCCATGCCGGGGATGAAAATGCCCGCCGCATGCCGACCAGCGCCCTGCGGCCCATTGCGTTCGATGACG
ACACATCCCTGATCCCCTGGCCTGCGGGCAGCTTCACCGGCTACCGGACCCTGACCGAATTCGCCGCCCT
GCCCGAGAAGTTTCTGTTCTTCGATCTGCATCTTGACCGGGTGGTGGAAACGGACCGGCTGGACCTTTAC
CTCTACTTCGACATGCCGCCGGGCGACGTGCTGAAATCCGTGGGCGCGCATTCCGTGACGCTGCACGCGA
CGCCCGCCGTCAACCTCTTCGCCAGTCAGGCCGAACCCATTGCGCTTGATGGCACACGCTCGGCCTATCC
GCTGGCCGCCGATGCGCGCCGCCCGCGCACCCGCGCCGTGCATTCGGTGCGCCGGGTCACTGTCGCGAAC
GGGGACGGCACCTCTGCCACCAGTGCACCGATTTTCCACCGGCTGACCGACCACCAGCGCGGCGGGACCT
TCTGGCACCTGCGCCGCCATTCCGAAGATCAGGGCCACGCCCCGGGGGCCACATCGCTGGCCTTCGTGGA
TGCCCGTAACCAGCCCGATGCGCCCAACGACAGCACGGCCAGCATTGACATCCTGACCACCAACGCCAAC
CTGCCACGCAAGCTGCCCTTTGGTGGCGGTCAACCGGCGCTGTCGCTCGCCTCTCCGATTGACCATGTGT
CGGGCGTCACGTGCCTGCGCGCGCCCACCCCGCCGCGGGCCCCCGGGGCCGATGCCGACCGCGCCTGGCA
ATTGATGTCGCATCTGTCGCTCAACCACCTGTCCCTGACCGACAGCGGCGCGCCTGCCCTGCGCGATATC
CTGCGCCTGTATGACCCCGGCGATGGGCCCGAGATGGCGCAGTTGATCGACGCCATTGATGACGTGTCCA
CCCGGACTGGCCTCGCGCGGATCGACGGCGTCACCGTGACCGGCACCGATATCACGCTGGCCTTTGATGA
CAGCCGCATCGCGCCCGGTCAGGCGGTGGTCTTCGCTTCTGTGCTGGACCGGTTCTTCGGCTGCTACACG
ACGCTCAACACCTTCACACGGCTGTCGGTGCGGATGCGCGACCGGACCGATTGGCTGGCCAAGTTTGCTG
CGCGCGCGGGGGAGGCGGCGCTGATATGA