SecReT6
Protein ID: 89055523
SecReT6 ID118
T6SS typei5
Gene symbol-
Locus tagJann_3032
StrainJannaschia sp. CCS1
Repliconchromosome [GenBank: NC_007802] [Browse all T6SS(s) in this replicon]
Location [Strand]3053865..3055115 [+]
ProductFHA domain-containing protein
NoteFha
UniProt IDQ28MW3
KEGG IDjan:Jann_3032
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 416 a.a.     [Download]
>gi|89055523|ref|YP_510974.1| unnamed protein product [Jannaschia sp. CCS1]
MSLVLELIDSGERRIVQEARAFTLGSFPGATWSLPQSPGAVPAGEVRILPDGASATVTLLRGAASLDQRA
LADDPRPLPSDAVLQIGSHRVRAQYRTDLITSHATEAPTISAILADVTPGGITAASPVPARSEDDWIAEL
TGDGPGTRPDWDNLGRYTGRDTAQAAEPNPLDTLPSGNAFLPDDWDDAGTDTQNRMAQSVLPGHVMAARD
SVTSEAAPNSIAPDALTLAFLKGAEILPEEVTPLGPAQMQALGALLLQALDGIAALEAARARRAADLGLP
RPPLTRDAFATLFAALQSGPDAARDLAARLADLALDGDAVLRGAQAFAADARDALDPAVIEAAAADGGVM
TRLAGGRSRAAWATYRARVTGQGGTEDGGDPPPPLSEAALLSAIAARYGKTSTEAIDDTDESGGTG
 
Nucleotide Sequence: 1251 bp     [Download]
>gi|89052491|ref|NC_007802.1|:3053865-3055115 Jannaschia sp. CCS1 chromosome, complete genome
ATGAGCCTAGTGCTGGAATTGATCGACAGCGGCGAACGCCGGATCGTGCAAGAGGCGCGCGCCTTTACCC
TCGGCAGTTTTCCGGGGGCCACTTGGTCGCTGCCGCAATCTCCCGGCGCGGTCCCCGCCGGGGAGGTGCG
CATTCTGCCCGATGGGGCGTCCGCCACCGTGACGTTGTTGCGCGGTGCGGCCAGCCTAGATCAGCGCGCC
TTGGCCGATGACCCGCGCCCCCTGCCCTCTGACGCCGTCCTGCAAATCGGGTCGCACCGTGTGCGGGCAC
AATATCGCACTGATCTGATCACCTCCCATGCGACCGAGGCCCCGACAATCAGCGCGATCCTCGCCGATGT
GACACCCGGGGGGATCACGGCGGCCAGTCCCGTGCCCGCCCGATCCGAGGATGACTGGATCGCAGAGCTG
ACCGGCGATGGCCCCGGCACGCGTCCCGATTGGGATAATCTTGGCCGGTATACGGGTCGGGACACCGCTC
AGGCAGCAGAGCCAAACCCGCTGGACACCCTGCCGTCGGGCAACGCCTTCCTCCCCGACGACTGGGATGA
CGCGGGCACCGATACCCAGAACCGCATGGCCCAATCGGTCCTGCCCGGTCATGTCATGGCCGCAAGGGAC
AGCGTCACGTCAGAGGCCGCGCCCAACAGCATTGCGCCGGACGCGCTGACCCTCGCGTTTCTCAAAGGGG
CTGAGATCCTGCCCGAAGAAGTTACCCCCCTCGGTCCCGCTCAGATGCAAGCCCTGGGTGCACTCTTGCT
GCAGGCGCTTGACGGGATCGCCGCGCTGGAAGCCGCCCGAGCGCGGCGCGCCGCCGATCTGGGCCTGCCA
CGCCCCCCCCTGACCCGCGACGCCTTCGCCACGCTCTTCGCGGCCTTGCAATCGGGGCCGGACGCGGCCC
GTGATCTGGCCGCCCGGCTGGCGGATTTGGCCTTGGATGGCGACGCGGTGCTGCGTGGTGCGCAGGCCTT
CGCCGCCGACGCCCGGGACGCGCTGGACCCCGCGGTGATTGAGGCGGCCGCCGCTGATGGAGGCGTAATG
ACGCGCTTGGCCGGGGGCCGCAGCCGCGCCGCCTGGGCCACCTATCGCGCCCGGGTCACCGGCCAGGGCG
GAACGGAGGACGGCGGCGATCCGCCACCCCCCCTGTCCGAGGCCGCGCTGCTGTCCGCAATCGCGGCGCG
CTACGGAAAGACCAGCACAGAAGCCATTGATGACACTGATGAATCGGGGGGAACCGGGTGA