SecReT6
Protein ID: 89055524
SecReT6 ID118
T6SS typei5
Gene symbol-
Locus tagJann_3033
StrainJannaschia sp. CCS1
Repliconchromosome [GenBank: NC_007802] [Browse all T6SS(s) in this replicon]
Location [Strand]3055112..3056443 [+]
Producthypothetical protein
NoteTssK
UniProt IDQ28MW2
KEGG IDjan:Jann_3033
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 7.60E-147, Aligned region: 19..442
Protein Sequence: 443 a.a.     [Download]
>gi|89055524|ref|YP_510975.1| unnamed protein product [Jannaschia sp. CCS1]
MKTDNRIAWTEGMFLRVQHFQQADRWTERLVRDRTGALTPYPWGLTQIALDRSALGVGRVALSSVAGILP
DGTPFSAPDLADLPAPVELAEGSGATTVYLAMQMRRSGQPEYGPAARPNARHKREEYEAEDANSDTSFTA
AIDVGRAALSLKTDADEREGFECLPIARVVETRADLSVVLDEAMIPPLMIVGANPRLHGYLTEIVGLLRH
RAAAIARRMGDPSIRGAAEIGDYMMLQALNRATPLIAHLEGQAGQIHPEGAFRQLVALAGELATFTASDN
VAPDMPQYLHMDPEATFAPVMDELRRSLSAVLDQSATPIPLELRRHGVRVGMIADAGLKHDASMVLAARA
DLPAEQLRRALPNQIKIGPVERIAELVNVALPGIPVRPLPVAPRQLPYRAGSVYFELDTSDDLWRTTSDG
GAIAIHLATDIPGLDLELWGIRG
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|89052491|ref|NC_007802.1|:3055112-3056443 Jannaschia sp. CCS1 chromosome, complete genome
GTGAAGACTGACAACCGCATCGCCTGGACCGAGGGCATGTTCCTGCGCGTCCAGCATTTCCAGCAGGCCG
ACCGATGGACGGAGCGTCTTGTGCGTGACCGCACGGGGGCGCTGACACCCTATCCCTGGGGCCTGACGCA
GATCGCGCTGGACCGCTCGGCCCTTGGCGTGGGGCGCGTTGCGCTGTCTTCCGTGGCGGGTATCCTGCCC
GACGGCACGCCGTTTTCCGCCCCCGATCTGGCCGATCTGCCCGCGCCGGTTGAGCTGGCCGAGGGGTCCG
GTGCCACGACCGTCTACCTCGCCATGCAGATGCGCCGCAGTGGCCAGCCCGAATACGGCCCCGCCGCCCG
CCCCAATGCCCGCCACAAGCGCGAAGAATACGAGGCCGAGGATGCCAATTCCGACACCTCCTTCACCGCT
GCCATAGATGTCGGTCGCGCGGCGCTGTCCCTCAAAACCGATGCGGATGAGCGGGAAGGGTTTGAATGCC
TGCCCATCGCCCGCGTGGTGGAAACCCGTGCGGACCTGTCGGTCGTGCTGGACGAGGCGATGATCCCGCC
CCTGATGATCGTCGGAGCCAATCCGCGTCTCCATGGTTATCTGACTGAAATCGTTGGCCTTCTGCGCCAC
CGTGCCGCCGCCATTGCCCGTCGCATGGGCGATCCGTCGATCCGGGGCGCGGCCGAAATCGGCGACTACA
TGATGCTTCAGGCGCTCAACCGCGCCACGCCTTTGATCGCCCATCTGGAAGGCCAGGCTGGCCAAATCCA
CCCCGAAGGTGCGTTTCGCCAATTGGTGGCGCTGGCCGGTGAGTTGGCCACCTTCACCGCGTCTGACAAC
GTCGCGCCCGATATGCCCCAGTACCTTCACATGGACCCGGAAGCGACCTTCGCCCCGGTGATGGATGAAC
TCCGCCGTTCGCTGTCTGCGGTGCTGGACCAATCCGCCACACCGATCCCGCTGGAACTGCGCCGCCACGG
CGTGCGTGTCGGTATGATCGCCGATGCGGGTCTCAAACACGACGCCTCCATGGTGCTGGCCGCCCGTGCC
GATCTGCCCGCCGAACAGCTGCGTCGTGCCCTGCCGAACCAGATCAAGATCGGGCCGGTGGAACGCATCG
CCGAACTGGTCAACGTCGCCCTTCCGGGCATCCCCGTGCGGCCCCTGCCGGTGGCCCCGCGCCAGCTGCC
CTACCGCGCCGGGTCCGTCTATTTTGAACTGGACACATCCGATGATCTCTGGCGGACCACGTCCGACGGA
GGGGCCATCGCCATCCATCTGGCCACCGATATTCCCGGCCTTGATCTTGAGCTGTGGGGGATCCGGGGAT
GA