SecReT6
Protein ID: 89055525
SecReT6 ID118
T6SS typei5
Gene symbol-
Locus tagJann_3034
StrainJannaschia sp. CCS1
Repliconchromosome [GenBank: NC_007802] [Browse all T6SS(s) in this replicon]
Location [Strand]3056440..3057903 [+]
ProductOmpA/MotB protein
NoteTssL
UniProt IDQ28MW1
KEGG IDjan:Jann_3034
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.60E-55, Aligned region: 64..265
OmpA [PF00691], Evalue: 7.20E-12, Aligned region: 356..452
Protein Sequence: 487 a.a.     [Download]
>gi|89055525|ref|YP_510976.1| unnamed protein product [Jannaschia sp. CCS1]
MSRPDHDDAEDAPRIIMPTPGGKRPEVEPEAAPGPADPPAPDPAPSVSDILSGFRFAGGDLPVMVAQAAP
LLNLAHALRTGQTPPAIGDLRRSLTGAARTYEAALATAGIVPDQARAAHYVVCATLDDVIRNTDWGAEWA
VEGLVSTFHHDVHGGDKVFALLTHFQRTPRANRDLLLLIYLCLSLGFEGRARVSSRGAAELALVRENLFR
TLRTEFDIVERDLSPLWQGEDAAHSPVRRSVAFWSITGVILLALIGVFLVYTLLLNRAAEATLARLATLP
PGAPPSLALPDPPAPDPVVEPPAPADPPVVTPEDPPQVPPIDTFIAFLQPEVDDGLVRLYREGDAVLVRV
ANAGAFGSGSAEIEDDFIDVFDRIGQALAAEDFAVTVLGHTDNVAIRTAPFPNNYFLSRARANAVRDVLL
QYVDPVRVDIEGQGPDRPIASNITPAGQEANRRTEILVREPGDRVPDSLLTQGVQPAEEAEPQEQTP
 
Nucleotide Sequence: 1464 bp     [Download]
>gi|89052491|ref|NC_007802.1|:3056440-3057903 Jannaschia sp. CCS1 chromosome, complete genome
ATGAGCCGACCGGACCACGATGACGCAGAGGACGCCCCGCGCATCATCATGCCGACACCCGGTGGCAAAC
GCCCGGAGGTGGAGCCTGAAGCAGCCCCCGGCCCCGCTGACCCGCCCGCGCCCGACCCTGCGCCGTCGGT
CTCGGACATCCTGTCCGGGTTCCGCTTCGCGGGCGGCGATCTGCCGGTCATGGTGGCGCAGGCAGCACCC
CTTCTGAACCTCGCCCATGCGCTCCGCACCGGGCAGACCCCGCCCGCCATCGGTGACCTGCGCCGCTCCC
TCACCGGGGCCGCGCGCACCTATGAAGCCGCGCTTGCCACGGCGGGCATCGTTCCCGATCAGGCCCGCGC
CGCCCATTACGTCGTCTGTGCCACGCTCGATGATGTGATCCGCAACACCGACTGGGGCGCGGAATGGGCC
GTTGAAGGGCTGGTGTCCACCTTCCACCATGACGTCCACGGCGGCGACAAGGTCTTTGCCCTCCTGACCC
ATTTTCAACGCACGCCGCGCGCGAACCGCGACCTGTTGCTACTGATCTACCTCTGCCTGTCGCTGGGGTT
TGAAGGCCGCGCCCGTGTCTCATCCCGGGGCGCGGCGGAACTGGCGTTGGTGCGCGAAAACCTGTTCCGC
ACCCTGCGCACCGAATTTGACATCGTGGAACGGGATCTGTCTCCGCTCTGGCAGGGCGAAGACGCCGCCC
ACTCCCCGGTGCGGCGCAGCGTGGCGTTCTGGTCGATCACCGGGGTGATCCTGCTGGCGCTCATTGGCGT
ATTCCTCGTCTATACCCTGCTGCTGAACCGCGCGGCCGAGGCGACGCTGGCGCGCCTCGCCACACTCCCC
CCCGGGGCGCCGCCGTCCCTCGCCCTGCCGGACCCGCCCGCACCTGATCCGGTGGTGGAGCCGCCCGCGC
CTGCTGACCCGCCCGTTGTGACGCCCGAAGACCCGCCGCAGGTGCCGCCCATCGACACCTTCATCGCCTT
CCTCCAGCCTGAGGTCGACGACGGCCTCGTGCGGCTCTACCGCGAAGGGGACGCGGTGCTGGTGCGGGTT
GCCAATGCGGGCGCGTTCGGCTCCGGCTCCGCCGAGATTGAGGATGACTTTATTGATGTCTTCGATCGCA
TCGGGCAGGCGCTGGCGGCGGAAGATTTCGCCGTCACCGTTCTGGGCCATACCGACAATGTCGCCATCCG
CACCGCGCCCTTTCCGAACAATTACTTCCTGTCGCGCGCCCGCGCCAACGCCGTGCGCGACGTGCTTCTG
CAATACGTGGATCCGGTGCGTGTGGACATCGAAGGTCAGGGCCCCGACCGGCCCATCGCCTCCAACATCA
CGCCCGCCGGGCAAGAGGCCAATCGCCGGACCGAGATCCTTGTGCGCGAGCCCGGGGACCGGGTCCCCGA
CAGCCTGCTGACCCAGGGCGTGCAACCCGCCGAAGAGGCAGAGCCACAGGAGCAGACGCCATGA