SecReT6
Protein ID: 89255546
SecReT6 ID466
T6SS typeii
Gene symbol-
Locus tagFTL_0109
StrainFrancisella tularensis subsp. holarctica LVS
Repliconchromosome [GenBank: NC_007880] [Browse all T6SS(s) in this replicon]
Location [Strand]102157..102558 [+]
Producthypothetical protein
NotePdpD
UniProt IDQ2A363
KEGG IDftl:FTL_1155, ftl:FTL_0109
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 133 a.a.     [Download]
>gi|89255546|ref|YP_512907.1| hypothetical protein FTL_0109 [Francisella tularensis subsp. holarctica LVS]
MNENKNLLKDICYTVEKSGVTGIVVESTFSYSPELFKENQQDIKLNIKNMSVRVRDGKVKRVTSIDRNAN
TEAILQSIYDNIIAFDEQDLERLFTGFRILKQENSTNTNKAVFNIGLTYHPITNNAFVEFNKD
 
Nucleotide Sequence: 402 bp     [Download]
>gi|89255449|ref|NC_007880.1|:102157-102558 Francisella tularensis subsp. holarctica LVS chromosome, complete genome
GTGAATGAAAATAAAAATTTGTTGAAAGATATTTGCTACACTGTCGAAAAAAGTGGTGTTACAGGAATAG
TGGTTGAATCGACATTTAGCTATTCGCCAGAACTCTTCAAAGAAAATCAACAAGATATTAAGCTTAACAT
TAAAAACATGTCAGTCAGAGTACGAGATGGTAAAGTCAAGAGGGTTACCAGCATTGATAGGAATGCTAAT
ACTGAAGCTATCTTACAAAGTATTTATGATAATATAATTGCGTTTGATGAACAAGATTTAGAAAGACTAT
TTACGGGGTTTAGGATTTTAAAACAAGAAAATTCGACAAACACTAATAAAGCCGTTTTCAATATTGGTTT
AACATATCATCCAATAACTAATAATGCTTTTGTTGAATTTAATAAGGATTAA