SecReT6
Protein ID: 89255549
SecReT6 ID466
T6SS typeii
Gene symbol-
Locus tagFTL_0112
StrainFrancisella tularensis subsp. holarctica LVS
Repliconchromosome [GenBank: NC_007880] [Browse all T6SS(s) in this replicon]
Location [Strand]103420..104940 [+]
Productintracellular growth locus, subunit B
NoteIglB
UniProt IDQ2A360
KEGG IDftl:FTL_1158, ftl:FTL_0112
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.50E-144, Aligned region: 73..497
Protein Sequence: 506 a.a.     [Download]
>gi|89255549|ref|YP_512910.1| intracellular growth locus, subunit B [Francisella tularensis subsp. holarctica LVS]
MTINKLSLTDELLNNFGGSTEVDSVLKNIDFDVSDDASKVLSLSTDYNARNLMALSLVLANNDNINNYNQ
KYIQKVITVIDRLIDLQVNSIISNDEFRALEQEWLKVQEVCQEDYDNVEVSILDVKKEELQYDFERNLYD
ISSSDFFKKVYVSEFDQYGGEPYGAILGLYNFENTTNDIIWLTGMGMVAKNSHAPFIASIDKSFFGVKDL
SEITHIKSFEALLEHPRYKEWNDFRNLDVAAYIGLTVGDFMLRQPYNPENNPVQYKLMEGFNEFVDYDKN
ESYLWGPASIHLVKNMMRSYDKTRWFQYIRGVESGGYVKNLVACVYDNKGILETKSPLNVLFADYMELSL
ANIGLIPFVSEKGTSNACFFSVNSAKKVEEFVDGFDSANSRLIANLSYTMCISRISHYIKCVIRDKIGSI
VDVESIQKILSDWISEFVTTVYQPTPLEMARYPFRNVSIEVKTIPGKPGWYSCKINVIPHIQFEGMNTTM
TIDTRLEPELFGTNNN
 
Nucleotide Sequence: 1521 bp     [Download]
>gi|89255449|ref|NC_007880.1|:103420-104940 Francisella tularensis subsp. holarctica LVS chromosome, complete genome
ATGACAATAAATAAATTAAGTCTCACTGATGAACTTTTAAATAATTTTGGGGGATCTACAGAAGTTGATA
GTGTACTCAAAAATATAGATTTTGATGTTTCAGATGATGCTTCTAAAGTTTTATCTTTATCTACTGACTA
CAATGCTAGAAACCTTATGGCGCTATCTTTGGTATTAGCAAATAATGATAATATAAATAATTATAATCAA
AAATATATCCAGAAAGTTATTACAGTTATTGATAGGCTTATTGATTTACAAGTTAATTCTATTATATCTA
ATGATGAGTTTAGAGCACTTGAGCAAGAATGGCTAAAGGTGCAAGAGGTTTGTCAAGAAGACTATGATAA
TGTTGAAGTAAGTATATTAGATGTAAAAAAAGAAGAGCTACAATATGATTTCGAGAGAAATTTATATGAT
ATATCTAGTAGTGACTTTTTCAAAAAAGTTTACGTTTCAGAATTTGATCAATATGGTGGAGAACCTTATG
GCGCAATATTAGGATTGTATAATTTTGAAAATACCACAAATGATATAATTTGGTTGACTGGAATGGGTAT
GGTGGCAAAGAATTCTCATGCACCATTTATTGCATCAATTGATAAGTCATTCTTTGGTGTTAAGGATTTA
TCAGAAATCACTCATATAAAAAGTTTTGAAGCTTTGCTTGAGCATCCTAGATATAAAGAGTGGAATGATT
TTAGAAACCTTGATGTTGCTGCATATATAGGTTTGACCGTAGGTGATTTTATGTTGCGGCAACCATATAA
TCCTGAGAATAATCCAGTTCAGTATAAACTTATGGAAGGCTTTAATGAGTTTGTTGATTATGATAAGAAT
GAAAGTTATCTATGGGGACCTGCTTCAATTCATCTAGTTAAGAATATGATGAGATCTTATGATAAAACTA
GATGGTTCCAATATATAAGAGGAGTTGAGAGTGGTGGTTATGTAAAGAACTTGGTAGCTTGCGTATATGA
TAATAAAGGCATTCTAGAAACTAAGTCACCTTTAAATGTATTATTTGCTGATTATATGGAGTTATCACTT
GCAAATATTGGTTTAATACCATTTGTAAGTGAAAAAGGTACTAGTAATGCTTGTTTTTTTAGTGTAAATT
CTGCTAAAAAAGTCGAAGAATTTGTAGATGGATTTGACTCAGCAAACTCAAGATTAATTGCTAACCTTTC
TTACACTATGTGTATATCGAGAATATCTCATTATATTAAATGTGTAATTAGAGATAAGATTGGTAGTATT
GTGGATGTCGAGTCGATTCAAAAAATTCTTTCTGATTGGATATCAGAATTTGTCACCACAGTCTATCAAC
CAACCCCTTTAGAAATGGCGAGATATCCTTTCAGAAACGTTTCTATCGAGGTTAAAACCATACCGGGTAA
GCCTGGCTGGTATTCATGCAAAATAAATGTAATTCCCCACATTCAATTTGAAGGAATGAATACTACAATG
ACTATAGATACTAGGCTTGAACCAGAATTATTCGGTACAAATAATAACTAA