SecReT6
Protein ID: 89255552
SecReT6 ID466
T6SS typeii
Gene symbol-
Locus tagFTL_0115
StrainFrancisella tularensis subsp. holarctica LVS
Repliconchromosome [GenBank: NC_007880] [Browse all T6SS(s) in this replicon]
Location [Strand]106810..107385 [-]
Producthypothetical protein
NotePdpE
UniProt IDQ2A357
KEGG IDftl:FTL_1161, ftl:FTL_0115
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 191 a.a.     [Download]
>gi|89255552|ref|YP_512913.1| hypothetical protein FTL_0115 [Francisella tularensis subsp. holarctica LVS]
MSKKIFKLLSISIIFSIYQQTFSNTITASTFELKNSSKKNATIFLNLNEFCPTNIAACKDENDNNCIYIT
ELVREPLSRIYYYLAVPITSKSVKDLTILYKHDKEESPPEAINICLSLFKNNKYETYYSQVIYNWFVSSE
LYLSFSEGSIFINKDINNSNNYDKGNFLRVNLERIADGWAPPHYEKKITII
 
Nucleotide Sequence: 576 bp     [Download]
>gi|89255449|ref|NC_007880.1|:c107385-106810 Francisella tularensis subsp. holarctica LVS chromosome, complete genome
ATGAGTAAAAAAATATTTAAATTATTATCAATTTCAATAATATTTAGTATATATCAACAAACATTTAGTA
ATACAATAACAGCTAGTACATTCGAACTAAAAAATAGTTCTAAAAAAAATGCTACTATCTTTCTAAATTT
GAACGAGTTCTGTCCGACTAATATAGCAGCATGCAAAGATGAGAATGACAATAATTGTATTTATATAACT
GAATTAGTTAGAGAACCTCTTAGTCGTATTTACTATTACTTAGCCGTGCCAATTACCAGCAAATCAGTTA
AAGACTTAACAATATTATATAAACATGATAAAGAAGAATCTCCACCAGAAGCAATAAATATATGTTTGAG
TTTATTTAAAAATAATAAGTATGAAACATACTATTCTCAAGTTATATATAATTGGTTTGTATCTTCAGAA
TTATATTTATCATTTAGTGAAGGATCTATTTTTATAAATAAAGATATTAATAATTCTAATAATTATGATA
AAGGTAATTTTCTAAGAGTAAATCTCGAACGTATAGCTGATGGCTGGGCTCCTCCTCATTATGAAAAGAA
AATTACTATAATATAA