SecReT6
Protein ID: 89255554
SecReT6 ID466
T6SS typeii
Gene symbol-
Locus tagFTL_0117
StrainFrancisella tularensis subsp. holarctica LVS
Repliconchromosome [GenBank: NC_007880] [Browse all T6SS(s) in this replicon]
Location [Strand]111429..112202 [-]
Producthypothetical protein
NoteIglJ
UniProt IDQ2A355
KEGG IDftl:FTL_0117, ftl:FTL_1163
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 257 a.a.     [Download]
>gi|89255554|ref|YP_512915.1| hypothetical protein FTL_0117 [Francisella tularensis subsp. holarctica LVS]
MKTILKIFLTYKQYWKILNMQHINNINKNISLNNFVSLLKSQKYSLKRINFIPVMINKTSSPTILDIYDN
KETLNVKINIFKIKPFTKLQSIYQEYIQNNNDLAIEILGYGLKVLLKLYILDTKALHKFTTKNSYYIQCA
PKYTIDNIINNIYKLLSEDYCTVIDYKEKLINIKRKQIVVGDSYVGKSFLGAYIPSYVYIINIKIYLISK
NQYVINKIKTQIKKIEEKITKLPFKIELEISIENNKKNQIYLSYFNL
 
Nucleotide Sequence: 774 bp     [Download]
>gi|89255449|ref|NC_007880.1|:c112202-111429 Francisella tularensis subsp. holarctica LVS chromosome, complete genome
ATGAAGACTATTTTGAAGATCTTTTTGACATATAAACAATATTGGAAGATATTAAATATGCAACACATCA
ATAATATCAATAAAAATATCTCTCTAAATAACTTTGTAAGTCTTCTAAAAAGTCAGAAATATTCTTTGAA
AAGAATAAATTTCATACCGGTAATGATTAATAAAACCTCATCTCCTACCATATTAGATATTTATGATAAT
AAAGAAACTCTAAATGTAAAAATAAATATCTTTAAAATCAAACCATTCACTAAATTACAGAGTATTTATC
AAGAATATATCCAAAACAATAATGACTTGGCTATTGAAATACTTGGATACGGATTAAAAGTGCTGCTAAA
GTTATACATTTTAGATACTAAAGCACTGCACAAATTCACAACAAAAAATAGTTATTATATTCAATGTGCT
CCCAAATACACTATAGATAACATAATAAACAATATCTATAAATTACTCTCGGAAGACTATTGCACAGTAA
TAGATTATAAAGAAAAACTAATCAATATAAAGAGAAAACAAATAGTAGTAGGAGATTCTTACGTTGGAAA
ATCTTTCTTGGGGGCATATATTCCTTCATATGTTTATATTATAAACATTAAGATATATCTCATTAGTAAA
AATCAATATGTCATAAATAAAATCAAAACTCAAATTAAAAAAATTGAGGAAAAAATTACAAAGCTCCCAT
TTAAGATAGAACTTGAAATATCAATTGAAAATAATAAAAAAAATCAGATATACCTAAGTTATTTTAATTT
ATGA