SecReT6
Protein ID: 89255559
SecReT6 ID466
T6SS typeii
Gene symbol-
Locus tagFTL_0122
StrainFrancisella tularensis subsp. holarctica LVS
Repliconchromosome [GenBank: NC_007880] [Browse all T6SS(s) in this replicon]
Location [Strand]116009..117673 [-]
Producthypothetical protein
NoteIglF
UniProt IDQ2A350
KEGG IDftl:FTL_0122, ftl:FTL_1168
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 554 a.a.     [Download]
>gi|89255559|ref|YP_512920.1| hypothetical protein FTL_0122 [Francisella tularensis subsp. holarctica LVS]
MNNNIDKWFENLFSNIHLYYKQEQSYKISKLNECITNVIKFINIKDYRKADIYNLTYVIEDVRYSTNLIL
SDSAIKFNDLILKKLDNLLDCTDINYFTSLMKNLKVLLEKYKLVIEKDISNRIELIKTKQIDKLESIFLD
YINNHSISAYDDSLVKLYVKTIQNPNSIEAIDEYKSYFDTLKIFIKDHKNIVSFIPFRKNPILSLLKLAY
LIRNGLYKTDRLLASDIILLRALYSINKDTYKLSLINEKTDTNLSIVSLTSLQAKPSENLKKTIAFIDLQ
IFAISQYFDDFPLQDIFFQKKSQIDIFKSESLEQLIFSLKNISNIMFDEETLYKKIHIKNQLYKNLFLNN
HNSLIEDIIEKSPANLLTKLANKYFQILLDIATIINIQLVNNNLKLIYPFLEFEKYFNQVTLEVSKKSQF
NQEKLEKNILNIIRIYPLLNQNYQLLKNMEQKIIDDKNSIESNDIYKLSVFVNSKSFSTYKEIRTLTSND
HKDINIHKSLVKLNKNICNAKHKNAAETAKELTMVLLSKSYYMNPTLIGVYNLPPISNSFFFGA
 
Nucleotide Sequence: 1665 bp     [Download]
>gi|89255449|ref|NC_007880.1|:c117673-116009 Francisella tularensis subsp. holarctica LVS chromosome, complete genome
ATGAATAATAATATTGATAAATGGTTTGAGAATTTATTTAGCAATATCCATTTATATTATAAACAAGAGC
AATCTTATAAAATAAGTAAGCTTAATGAGTGCATCACTAACGTAATCAAATTTATAAATATAAAAGATTA
TAGAAAAGCTGACATCTATAATCTGACCTATGTTATTGAAGATGTAAGATACTCAACGAATCTAATTTTA
TCTGACTCTGCAATTAAATTTAATGATTTAATATTAAAAAAATTAGATAACCTCTTAGATTGTACTGATA
TTAACTATTTTACTAGCCTTATGAAGAATTTAAAGGTTCTTTTAGAAAAGTATAAACTAGTAATAGAGAA
AGATATATCGAATAGAATAGAACTTATAAAAACTAAGCAGATCGATAAACTAGAATCTATATTTTTAGAC
TATATAAACAACCATAGTATCAGCGCTTATGATGATAGTCTTGTAAAATTATATGTAAAAACTATACAAA
ATCCCAATTCCATTGAGGCTATAGATGAGTATAAATCATATTTCGATACGCTCAAAATATTTATAAAAGA
TCATAAAAATATAGTTAGTTTTATTCCCTTTAGAAAAAATCCTATTTTAAGCTTATTGAAATTAGCTTAT
TTAATTAGAAATGGTTTATATAAAACAGATCGTCTTTTAGCTAGCGATATTATTCTTTTAAGAGCTTTAT
ATTCTATAAATAAAGATACATATAAATTAAGTCTTATAAATGAAAAAACAGATACTAACCTATCAATAGT
TTCGCTGACGTCACTACAAGCTAAGCCCTCAGAAAACTTAAAAAAAACTATTGCTTTTATAGATTTACAG
ATATTTGCTATATCTCAGTATTTTGATGATTTCCCTTTACAGGATATTTTTTTTCAAAAAAAATCACAAA
TAGACATTTTCAAGTCAGAATCACTAGAACAACTTATTTTCAGTTTAAAAAATATTTCAAATATAATGTT
TGATGAAGAAACACTATATAAAAAAATCCATATAAAAAATCAACTCTACAAAAACCTTTTTTTAAATAAT
CACAATAGTTTGATAGAAGATATTATAGAAAAATCTCCAGCAAACTTATTAACAAAGTTAGCTAATAAAT
ACTTCCAAATACTGCTAGACATAGCAACAATAATAAATATTCAATTAGTAAATAATAATTTAAAGCTTAT
TTATCCTTTCTTAGAGTTTGAAAAATATTTTAATCAAGTAACTTTAGAAGTATCAAAAAAATCACAGTTT
AATCAAGAAAAGCTAGAAAAGAATATTCTAAATATTATCAGGATATATCCTTTACTAAATCAAAACTACC
AATTATTAAAGAATATGGAACAAAAAATTATTGATGATAAAAATAGTATAGAATCAAACGATATATATAA
GCTTAGTGTTTTTGTAAATAGCAAAAGTTTTTCTACCTATAAAGAAATCAGAACCTTAACCTCAAATGAC
CATAAAGATATTAACATACACAAATCTTTAGTAAAACTGAACAAAAATATTTGTAATGCCAAACATAAGA
ATGCCGCTGAAACAGCTAAAGAGCTAACGATGGTTCTTTTAAGTAAATCTTACTATATGAATCCAACTTT
GATAGGAGTATATAATCTACCGCCAATTTCAAATAGTTTTTTTTTTGGTGCTTAA