SecReT6
Protein ID: 89255561
SecReT6 ID466
T6SS typeii
Gene symbol-
Locus tagFTL_0124
StrainFrancisella tularensis subsp. holarctica LVS
Repliconchromosome [GenBank: NC_007880] [Browse all T6SS(s) in this replicon]
Location [Strand]118185..118562 [-]
Producthypothetical protein
NoteIglE
UniProt IDQ2A348
KEGG IDftl:FTL_1170, ftl:FTL_0124
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 125 a.a.     [Download]
>gi|89255561|ref|YP_512922.1| hypothetical protein FTL_0124 [Francisella tularensis subsp. holarctica LVS]
MYNKLLKNLCLVLSTIIGLSSCISDGLYINNNIPKTKIVLESKPDKNIFYSDNYQSISQRIYDDNVKVLN
LKTGKNEFPLDKDIKDYALYFILPENKKTENWKYIISSDSVNKFTIKNDSSIEKD
 
Nucleotide Sequence: 378 bp     [Download]
>gi|89255449|ref|NC_007880.1|:c118562-118185 Francisella tularensis subsp. holarctica LVS chromosome, complete genome
ATGTACAATAAATTATTGAAAAATCTTTGTTTAGTATTATCCACAATCATAGGGCTTAGCAGTTGTATTA
GTGATGGTTTGTATATCAACAACAATATTCCTAAGACAAAAATAGTTCTAGAATCTAAACCTGATAAAAA
TATTTTCTACTCAGATAACTATCAATCTATTTCTCAAAGAATATATGATGATAATGTAAAAGTATTAAAT
CTTAAAACAGGAAAGAATGAATTTCCATTAGATAAAGATATCAAGGATTATGCCTTGTATTTTATACTTC
CTGAAAATAAAAAAACTGAAAACTGGAAATACATAATAAGTTCAGATTCTGTAAATAAATTTACTATAAA
AAATGATAGTAGCATAGAAAAAGATTAA