SecReT6
Protein ID: 89255563
SecReT6 ID466
T6SS typeii
Gene symbol-
Locus tagFTL_0126
StrainFrancisella tularensis subsp. holarctica LVS
Repliconchromosome [GenBank: NC_007880] [Browse all T6SS(s) in this replicon]
Location [Strand]121838..124300 [-]
Producthypothetical protein
NotePdpA
UniProt IDQ2A346
KEGG IDftl:FTL_0126, ftl:FTL_1172
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 820 a.a.     [Download]
>gi|89255563|ref|YP_512924.1| hypothetical protein FTL_0126 [Francisella tularensis subsp. holarctica LVS]
MIAVKDITDLNIQDIISQLTSEVINGDTTSSSAKFACEINSYIINYKLLNINLINTQLKNTKILYRKGLI
SKLDYEKYKRYCVICRLKNNIDEFILYFSTNYKDSQSLKIAIKELQNSCSSSLILELPHDYIRKIDVLLT
SIDSAIQRSSDLNKTIIKQLNKLKSSLSRYIGYNNVLQKQEITINIKPINKNFELEDISFVSTRNKQYFK
HNSLTLKNPHIEKLEVCENIYGINGWLTFDLAYINNHKDFNFLLSPNQPILFDIQINDSFNFYKKESKKD
HHKRTTRFMAIGFNSNSIDIHENFEYSIYSYTKNVSSGVKKIKIQFHDPLKALWTKHKPSYIALNKSLDD
IFKENFFFDNLVSLDTNKSNNLKIRIPQAFISTVNRNFYDFFIQQLEQNKCYLKYFCDKKSGKVSYHVVD
QVDNDLQRNIVNSDEDLKDKLSPYDISCFKKQILISNKSNFYVKEKNICPDVTLTTQKKEDRKISDTLIK
PFSSILKDNLQSVEYIQSNNDDIQEIITTGFEILLTSRNTLPFLDTEITLSKLDNDQNYLLGATDIKSLY
ISQRKLLFKRSKYCSKQLYENLHNFHYKSDSESDVYEKIAFTKYPSLTHDNLITYKIKNYSNLTPEYPKY
KSFSNFYINGRVTIGENVNNDSKKAYKFFKNYKPEESSIAEFQENGEKGTSAILNSKADILYAIEIAKEM
LSDKSSDKPIIYLPLKVNINSANNQFIPLRNDDIILIEMQSFTKGEIIELISNSAISTKKAQQQLLQRQL
LGSKENCEMAYTQTSDSETFSLTQVNEDCENSFLINDKKGIFLRYKSKGN
 
Nucleotide Sequence: 2463 bp     [Download]
>gi|89255449|ref|NC_007880.1|:c124300-121838 Francisella tularensis subsp. holarctica LVS chromosome, complete genome
ATGATAGCAGTAAAAGATATAACTGATTTAAATATACAAGACATAATTAGTCAGTTAACTTCTGAAGTTA
TAAATGGCGACACAACCTCTTCTTCTGCCAAGTTTGCTTGTGAAATTAATAGCTATATTATTAATTACAA
ACTATTAAACATTAATCTTATTAATACTCAACTAAAAAATACAAAGATACTTTATAGAAAAGGCTTGATA
TCTAAGCTTGATTACGAAAAATATAAAAGATATTGCGTAATATGTAGATTAAAAAATAACATAGATGAAT
TTATCTTATATTTTTCGACAAACTATAAAGACTCTCAAAGCTTAAAAATCGCAATTAAAGAATTACAAAA
CTCATGCTCATCAAGTTTAATTCTTGAGCTCCCTCATGATTACATAAGAAAAATTGATGTCTTACTAACT
AGTATAGATAGTGCGATACAAAGATCAAGTGATCTCAACAAAACAATTATAAAACAGTTAAATAAGCTTA
AAAGCAGCCTTTCACGATATATTGGGTATAATAATGTACTGCAAAAACAAGAAATTACTATAAATATAAA
GCCTATTAATAAAAATTTTGAACTTGAGGATATAAGTTTTGTATCAACTAGAAATAAGCAATATTTTAAG
CATAACTCTCTTACACTTAAAAATCCTCATATTGAAAAATTAGAAGTATGTGAAAATATCTACGGCATAA
ATGGCTGGTTAACTTTTGATTTAGCATATATCAATAATCACAAAGACTTTAACTTCCTATTAAGCCCAAA
TCAACCCATATTATTTGATATTCAAATTAATGATAGCTTCAATTTTTACAAAAAAGAATCTAAAAAAGAT
CATCATAAGAGAACAACCCGTTTTATGGCCATTGGCTTTAATTCAAACAGTATAGATATTCATGAGAACT
TTGAATACAGCATATATTCTTATACCAAAAATGTTTCTTCAGGAGTAAAAAAAATTAAAATACAATTCCA
TGACCCACTAAAAGCACTTTGGACTAAGCACAAACCATCTTATATAGCTTTAAATAAAAGCTTAGATGAT
ATCTTTAAAGAGAATTTTTTCTTTGATAATTTAGTTTCTTTAGATACCAACAAAAGTAATAACCTAAAAA
TACGTATACCACAAGCATTTATTTCTACAGTTAATCGAAATTTTTATGATTTTTTTATTCAACAACTTGA
GCAAAATAAATGCTATTTAAAATATTTCTGTGATAAGAAGAGTGGCAAAGTAAGCTATCATGTTGTAGAT
CAAGTAGATAATGACTTACAAAGGAATATCGTAAATTCAGATGAAGATTTAAAAGACAAACTATCTCCTT
ATGATATAAGCTGCTTCAAAAAACAAATTCTAATCTCAAATAAATCAAACTTTTATGTTAAAGAAAAAAA
TATATGTCCTGATGTGACTTTAACCACTCAAAAAAAGGAAGATCGAAAGATTTCAGATACCCTAATAAAG
CCATTCTCATCCATACTCAAGGATAACTTACAATCTGTAGAGTATATACAAAGCAATAATGATGATATAC
AAGAAATTATTACTACAGGATTTGAGATATTACTGACATCAAGAAATACTCTGCCCTTCTTAGATACTGA
AATTACTCTTTCTAAACTAGACAATGATCAAAACTATCTTTTAGGCGCAACAGATATAAAAAGCTTATAT
ATAAGTCAAAGAAAGCTATTATTTAAAAGAAGTAAATACTGCTCTAAACAACTATATGAAAACTTACATA
ATTTTCACTATAAAAGTGATTCTGAATCAGACGTATATGAAAAAATTGCTTTTACTAAATACCCTAGTCT
GACACATGACAACTTAATAACTTATAAAATTAAGAATTATAGTAATCTAACTCCTGAATATCCTAAGTAC
AAAAGTTTTAGTAACTTTTATATTAATGGTAGAGTAACGATTGGAGAAAATGTTAATAATGACTCCAAAA
AAGCTTATAAATTCTTTAAAAATTATAAGCCAGAAGAAAGCTCAATCGCAGAATTTCAAGAAAATGGTGA
AAAAGGTACTTCAGCTATACTAAATAGTAAGGCTGATATCTTATACGCAATAGAAATTGCCAAGGAAATG
TTATCTGATAAATCATCAGATAAGCCAATCATATACTTACCTCTAAAAGTAAACATAAATTCTGCTAATA
ATCAATTTATACCATTGAGAAATGACGATATTATCTTAATTGAAATGCAGTCTTTTACTAAAGGTGAAAT
TATTGAGTTAATTTCAAACTCTGCCATATCAACAAAGAAAGCTCAGCAGCAACTACTACAACGACAACTT
CTTGGATCTAAAGAAAACTGTGAAATGGCATATACCCAAACAAGTGATAGCGAGACATTCTCACTAACTC
AAGTAAATGAAGATTGTGAGAATTCTTTTTTGATAAATGATAAAAAAGGTATTTTTCTAAGATATAAATC
AAAAGGAAATTAA