SecReT6
Protein ID: 89256477
SecReT6 ID467
T6SS typeii
Gene symbol-
Locus tagFTL_1155
StrainFrancisella tularensis subsp. holarctica LVS
Repliconchromosome [GenBank: NC_007880] [Browse all T6SS(s) in this replicon]
Location [Strand]1096796..1097197 [+]
Producthypothetical protein
NotePdpD
UniProt IDQ2A363
KEGG IDftl:FTL_1155, ftl:FTL_0109
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 133 a.a.     [Download]
>gi|89256477|ref|YP_513839.1| hypothetical protein FTL_1155 [Francisella tularensis subsp. holarctica LVS]
MNENKNLLKDICYTVEKSGVTGIVVESTFSYSPELFKENQQDIKLNIKNMSVRVRDGKVKRVTSIDRNAN
TEAILQSIYDNIIAFDEQDLERLFTGFRILKQENSTNTNKAVFNIGLTYHPITNNAFVEFNKD
 
Nucleotide Sequence: 402 bp     [Download]
>gi|89255449|ref|NC_007880.1|:1096796-1097197 Francisella tularensis subsp. holarctica LVS chromosome, complete genome
GTGAATGAAAATAAAAATTTGTTGAAAGATATTTGCTACACTGTCGAAAAAAGTGGTGTTACAGGAATAG
TGGTTGAATCGACATTTAGCTATTCGCCAGAACTCTTCAAAGAAAATCAACAAGATATTAAGCTTAACAT
TAAAAACATGTCAGTCAGAGTACGAGATGGTAAAGTCAAGAGGGTTACCAGCATTGATAGGAATGCTAAT
ACTGAAGCTATCTTACAAAGTATTTATGATAATATAATTGCGTTTGATGAACAAGATTTAGAAAGACTAT
TTACGGGGTTTAGGATTTTAAAACAAGAAAATTCGACAAACACTAATAAAGCCGTTTTCAATATTGGTTT
AACATATCATCCAATAACTAATAATGCTTTTGTTGAATTTAATAAGGATTAA

Protein ID: 89256478
SecReT6 ID467
T6SS typeii
Gene symbol-
Locus tagFTL_1156
StrainFrancisella tularensis subsp. holarctica LVS
Repliconchromosome [GenBank: NC_007880] [Browse all T6SS(s) in this replicon]
Location [Strand]1097207..1097410 [+]
Producthypothetical protein
NotePdpD
UniProt IDQ2A362
KEGG IDftl:FTL_1156, ftl:FTL_0110
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 67 a.a.     [Download]
>gi|89256478|ref|YP_513840.1| hypothetical protein FTL_1156 [Francisella tularensis subsp. holarctica LVS]
MYSYNNLSKDAYVTKIKSIVDAKVALNLSFEHEEIRSSQGFSVLATVPARGYSIDDLNRKYRPMIWV
 
Nucleotide Sequence: 204 bp     [Download]
>gi|89255449|ref|NC_007880.1|:1097207-1097410 Francisella tularensis subsp. holarctica LVS chromosome, complete genome
TTGTACTCATATAATAATTTAAGCAAAGATGCGTATGTCACAAAAATTAAAAGTATAGTTGATGCTAAAG
TTGCTTTAAACCTTAGTTTTGAACATGAAGAGATTAGAAGTTCACAAGGTTTTAGTGTCTTAGCAACTGT
ACCAGCTAGAGGATATTCTATAGATGATTTAAATAGAAAGTATAGACCAATGATCTGGGTTTAA