SecReT6
Protein ID: 89256479
SecReT6 ID467
T6SS typeii
Gene symbol-
Locus tagFTL_1157
StrainFrancisella tularensis subsp. holarctica LVS
Repliconchromosome [GenBank: NC_007880] [Browse all T6SS(s) in this replicon]
Location [Strand]1097491..1098045 [+]
Productintracellular growth locus, subunit A
NoteIglA
UniProt IDQ2A361
KEGG IDftl:FTL_1157, ftl:FTL_0111
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.10E-42, Aligned region: 4..156
Protein Sequence: 184 a.a.     [Download]
>gi|89256479|ref|YP_513841.1| intracellular growth locus, subunit A [Francisella tularensis subsp. holarctica LVS]
MAKNKIPNSRLMINYETNVDGVLKKKELPYRVLVVGDLSKGRSVDAKKEFAYREVRRVNNGVDRVLEEMN
ISFDFEAPNFVSKDPSNLKVNYRIESVKDFRPDAVAKKVPEIRALLEMKEILASFAKDIENNRNLKKTID
MIFSDSNELESLKSKIPALTNYTIKDSCDAAGSQDLSNQQVDGK
 
Nucleotide Sequence: 555 bp     [Download]
>gi|89255449|ref|NC_007880.1|:1097491-1098045 Francisella tularensis subsp. holarctica LVS chromosome, complete genome
ATGGCAAAAAATAAAATCCCAAATTCAAGGTTGATGATAAATTATGAAACTAATGTTGATGGTGTCTTAA
AGAAAAAAGAGCTACCTTACAGAGTCCTAGTTGTTGGCGATTTATCAAAAGGAAGATCTGTGGATGCAAA
AAAAGAGTTCGCATATAGAGAGGTCAGAAGAGTAAATAATGGTGTTGATAGGGTTTTAGAAGAGATGAAT
ATATCTTTTGATTTTGAGGCACCAAACTTTGTTTCTAAAGATCCTAGTAATTTAAAAGTTAATTATAGAA
TTGAAAGTGTCAAAGATTTTAGACCTGATGCTGTTGCTAAAAAAGTTCCTGAAATCAGAGCGCTGCTTGA
AATGAAAGAGATATTAGCATCCTTTGCTAAGGACATTGAAAATAATCGTAATCTCAAGAAAACCATAGAT
ATGATTTTTTCAGATAGTAACGAATTAGAATCATTAAAGAGTAAGATTCCTGCTTTGACAAATTATACGA
TTAAAGACTCTTGTGATGCTGCTGGGTCTCAAGACTTAAGTAATCAACAAGTAGATGGTAAGTAG