SecReT6
Protein ID: 89256481
SecReT6 ID467
T6SS typeii
Gene symbol-
Locus tagFTL_1159
StrainFrancisella tularensis subsp. holarctica LVS
Repliconchromosome [GenBank: NC_007880] [Browse all T6SS(s) in this replicon]
Location [Strand]1099596..1100225 [+]
Productintracellular growth locus, subunit C
NoteIglC
UniProt IDQ2A359
KEGG IDftl:FTL_0113, ftl:FTL_1159
PDB IDNA
Domain hit(s) vs Pfam IglC [PF11550], Evalue: 1.10E-141, Aligned region: 1..209
Protein Sequence: 209 a.a.     [Download]
>gi|89256481|ref|YP_513843.1| intracellular growth locus, subunit C [Francisella tularensis subsp. holarctica LVS]
MSEMITRQQVTSGETIHVRTDPTACIGSHPNCRLFIDSLTIAGEKLDKNIVAIEGGEDVTKADSATAAAS
VIRLSITPGSINPTISITLGVLIKSNVRTKIEEKVSSILQASATDMKIKLGNSNKKQEYKTDEAWGIMID
LSNLELYPISAKAFSISIEPTELMGVSKDGMSYHIISIDGLTTSQGSLPVCCAASTDKGVAKIGYIAAA
 
Nucleotide Sequence: 630 bp     [Download]
>gi|89255449|ref|NC_007880.1|:1099596-1100225 Francisella tularensis subsp. holarctica LVS chromosome, complete genome
ATGAGTGAGATGATAACAAGACAACAGGTAACAAGTGGCGAGACCATTCATGTGAGAACTGATCCTACTG
CATGTATAGGATCTCATCCTAATTGTAGATTATTTATTGATTCTTTAACTATAGCTGGGGAGAAACTTGA
TAAAAATATCGTTGCTATAGAGGGTGGAGAGGATGTCACGAAAGCTGATTCGGCTACAGCTGCTGCTAGT
GTAATACGTTTATCTATAACGCCAGGCTCTATAAATCCAACAATAAGTATTACTCTTGGTGTTCTAATTA
AATCAAATGTTAGAACTAAAATTGAAGAGAAAGTTTCGAGTATATTACAAGCAAGTGCTACAGATATGAA
AATTAAGTTAGGTAATTCTAATAAAAAACAAGAGTATAAAACTGATGAAGCATGGGGTATTATGATAGAT
CTATCTAATTTAGAGTTATATCCAATAAGTGCTAAGGCTTTTAGTATTAGTATAGAGCCAACAGAACTTA
TGGGTGTTTCAAAAGATGGAATGAGTTATCATATTATATCTATAGATGGTCTTACAACATCTCAAGGAAG
CTTGCCAGTATGTTGCGCAGCTAGCACAGATAAAGGAGTTGCTAAAATAGGATATATTGCAGCTGCATAG