SecReT6
Protein ID: 89256482
SecReT6 ID467
T6SS typeii
Gene symbol-
Locus tagFTL_1160
StrainFrancisella tularensis subsp. holarctica LVS
Repliconchromosome [GenBank: NC_007880] [Browse all T6SS(s) in this replicon]
Location [Strand]1100246..1101442 [+]
Productintracellular growth locus, subunit D
NoteIglD
UniProt IDQ2A358
KEGG IDftl:FTL_0114, ftl:FTL_1160
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 0.00095, Aligned region: 43..103
DUF876 [PF05936], Evalue: 0.00095, Aligned region: 185..345
Protein Sequence: 398 a.a.     [Download]
>gi|89256482|ref|YP_513844.1| intracellular growth locus, subunit D [Francisella tularensis subsp. holarctica LVS]
MFLERIYWEDGLRLDSDILDKSNLSVLERLSTASYLPANLNKGIVSFDLDVESLQTGLILIKDLKLYLDE
KNFVFYDKSYPLSLQIMTDKLSDEIPLFLNIREKVIEKNGIKYIYNQLSLSLEHSYGFKHSIQIALFRLD
RGRLVPEIYDFPLLTLNHYYLGDIFVKLNRTVSELKSFNRFVFSASRSYASILLVFLINKLERELKFAES
NRANSSPKQIFDLIDDIYSLIQLNLDKVEELDSIEFDFQKPLTKLNLLADRLLTLCEYRKINNFIRFELH
GKKYICESFPEEFFVATRYYLFLKRKATAPANVRFENKNALRITSISRNKNIVALSLSGVKLVDVECSMI
NFTTRFDNIDAIYEIQKGSEWDFILADSSAVFTAFEGSENFDFFIAFS
 
Nucleotide Sequence: 1197 bp     [Download]
>gi|89255449|ref|NC_007880.1|:1100246-1101442 Francisella tularensis subsp. holarctica LVS chromosome, complete genome
ATGTTTCTAGAAAGGATTTATTGGGAAGATGGTTTAAGATTAGATAGCGATATTTTAGATAAGTCAAATC
TATCTGTTTTAGAAAGGTTAAGCACCGCGAGCTATTTGCCAGCTAATCTTAATAAGGGAATCGTTAGCTT
TGATTTAGATGTTGAAAGTTTGCAGACAGGTCTTATCCTTATAAAAGATCTTAAATTGTACTTAGATGAA
AAAAATTTTGTTTTTTATGATAAGTCTTATCCGTTATCTTTACAAATAATGACTGATAAGTTAAGTGATG
AAATCCCCTTATTTCTGAATATCAGAGAGAAAGTAATTGAAAAAAATGGGATTAAATATATCTATAATCA
ATTGTCATTATCATTAGAGCATAGCTATGGTTTTAAACATAGCATCCAAATTGCATTATTTAGGTTAGAT
AGAGGGCGATTAGTACCAGAAATTTATGACTTCCCGCTATTAACTCTTAATCATTATTATTTAGGTGATA
TTTTTGTAAAACTTAATAGGACTGTTTCTGAACTAAAGTCTTTTAATCGCTTTGTTTTTTCAGCTTCAAG
ATCTTATGCGTCAATATTACTTGTATTTTTGATTAATAAATTAGAAAGAGAATTGAAGTTCGCAGAATCT
AATAGGGCAAATAGTTCCCCGAAACAAATATTTGATTTAATTGATGATATTTACAGCTTAATTCAACTTA
ACCTAGATAAAGTTGAAGAGCTTGATAGCATTGAATTTGATTTCCAAAAGCCTTTGACTAAATTAAATCT
ACTTGCTGATAGATTATTAACTCTTTGTGAGTATAGAAAGATTAATAACTTTATCAGATTTGAATTGCAT
GGAAAAAAATATATATGTGAAAGCTTTCCTGAAGAGTTTTTTGTTGCTACTAGATACTATCTTTTCCTTA
AAAGGAAAGCAACAGCTCCAGCCAATGTAAGGTTTGAAAATAAGAATGCTCTGAGAATTACTAGTATAAG
TAGAAATAAGAATATTGTAGCTCTGTCTCTTTCAGGAGTAAAACTGGTTGACGTTGAATGTTCTATGATT
AATTTTACAACTAGATTTGATAATATTGATGCAATATATGAAATTCAAAAAGGTTCTGAGTGGGATTTTA
TATTAGCGGATAGTAGTGCGGTTTTTACGGCTTTTGAAGGTAGTGAGAATTTTGATTTCTTTATAGCCTT
TTCTTAA