SecReT6
Protein ID: 89256484
SecReT6 ID467
T6SS typeii
Gene symbol-
Locus tagFTL_1162
StrainFrancisella tularensis subsp. holarctica LVS
Repliconchromosome [GenBank: NC_007880] [Browse all T6SS(s) in this replicon]
Location [Strand]1102042..1106028 [-]
Producthypothetical protein
NotePdpC
UniProt IDQ2A356
KEGG IDftl:FTL_0116, ftl:FTL_1162
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 1328 a.a.     [Download]
>gi|89256484|ref|YP_513846.1| hypothetical protein FTL_1162 [Francisella tularensis subsp. holarctica LVS]
MNDKYELNIYFEKIELPKTADFNMISKHDIKELRVDANLKKKIHLLQFDEDYLAYMRSLRAIHPSKIAMQ
KIKSIRNKKNSFIIAILSLDKIIHKTKFITFGHKTVIFDFKKLWGLVDFVIVHTSNKTWVNHKLTSFMPS
ITYCNQNIIHLAYHSDFLYIYHTPEFMDDINVDRENRRRLVAKIPDPYWVRADTKENKINITSENKNLEK
DLKKITKLKNFEISANDIFFSKAIKAAPRLQHKNKSKLFNSLAIENNEKIKRDIIDYAISNAWYKNDGLL
ENLMTFLDALVVRHLYLIAVYSVYEIEIGIKSVKPEYSKLLKAGLLNKDIQNQLIYDQKKISNIIWLGET
FHGLDIEEAQALCEFLDEENINPKINPINSKKLYKTYKENYKSDSEKILSFTKYKEKYNFLNNDKLREEH
ANKLSSILEDPKFRVLSYINAFLCSTKNYLVPYGYLGSNPLTYYNCMLETGKRRTSKEAYFADIRNKLFI
VCYLPGFLSSVIADDDFIDWYSNKKENQELLKNSYLNNLYNSKQKYIKDFIDLDIIKLLKQTSSQIKPSY
IPVAFRYGAFASTTALIRSNANVSNRMEFELYDSPERLHNQYLEKEEMIMPKSVNNPKDHSIDNGVSLFS
LNLTNEKEDGLRKVMLKVAQLYNLDFKVGISGNLDQAMTQALILGMATTKKNGDIVIDEDQVLYMTYLYC
IFMAHSVDHTVDEILMSSNTYMLNSKEEKYPIANIANFFARPVFKLSKDKEFKALVEKYENSIKPNSKVL
KENYISRVTTLSEVYEDIYNLNCLYSSLSEGSLYNLLSTHSERNCTLLEQYSRKKKAETGLVQDGEKIKV
VNNYNGYAAINQYQRFVSLGIMYDSGAKYSSSHKKQIEKDFNLYSPDKEQINYLKYNFKDNKFDAVYKNK
KSKEKTQSHIVYAKKQNTRYCYGYFNNFFVKNRITTFYKIKDKSGNYLVNLHNEKYSFATPNSDSKIYRA
SPELLNNRDDFKRVSKDIIKSYKYISFDKQKEDIVKNFGKNLYHTNYEIWVGLSHQAISCFSVLDNIDTQ
EAANTFIDALYYIRLMQLYYGKTIPFLLISSEIVRYSSSETHYYIPTEENFENILKIALNSASKPVIERF
LIILNIYNNTIDDNTLILIRCRLTIILFEHEEQKLKLKALQKYADAYKKNNYKNEINFRAWFESIFHVQN
LSLSPNYIGNNILILSLVEELKPKCSEYKKNMINQQIIAKANELNFYQLIIRLIEISTYHRILTKSIITN
TTSLLYDILNKPEFQTINKSINKLFIYKNKDLNTDKYKAFHTKLITIEKTYKKINSLYKSDFFKKISS
 
Nucleotide Sequence: 3987 bp     [Download]
>gi|89255449|ref|NC_007880.1|:c1106028-1102042 Francisella tularensis subsp. holarctica LVS chromosome, complete genome
ATGAACGACAAATATGAACTAAATATCTATTTTGAGAAAATAGAGTTACCTAAAACAGCAGATTTCAATA
TGATAAGTAAGCATGATATTAAAGAACTCAGAGTAGATGCTAATTTAAAAAAGAAAATACACTTATTACA
ATTTGATGAAGATTATTTAGCATATATGAGGAGCTTAAGAGCTATTCATCCCTCAAAAATAGCGATGCAA
AAAATTAAATCAATTCGCAATAAAAAAAATTCTTTTATAATTGCCATTTTATCTTTAGATAAAATAATTC
ACAAAACTAAATTTATCACTTTTGGACATAAAACCGTTATTTTTGATTTTAAGAAACTATGGGGATTAGT
TGATTTCGTAATAGTTCATACAAGTAATAAAACCTGGGTTAATCATAAGTTAACATCATTTATGCCATCA
ATTACATACTGTAATCAAAACATCATCCATTTAGCATACCATTCTGATTTTTTATATATTTATCATACTC
CAGAATTTATGGATGATATAAATGTAGATCGAGAAAATAGAAGAAGGTTAGTGGCAAAAATTCCCGATCC
ATATTGGGTAAGAGCTGATACTAAAGAAAATAAAATCAATATTACTTCTGAAAATAAAAATCTAGAAAAA
GATTTAAAAAAAATAACTAAATTAAAAAATTTTGAAATAAGCGCAAATGATATTTTTTTCTCAAAAGCTA
TAAAAGCAGCTCCAAGATTACAACATAAAAATAAGAGTAAATTATTTAATTCATTAGCGATTGAAAATAA
TGAAAAAATCAAACGTGACATAATTGATTATGCAATATCTAATGCTTGGTATAAAAACGATGGGTTACTT
GAAAATCTAATGACATTTTTAGACGCTCTAGTCGTAAGACATCTCTACTTAATAGCAGTTTACTCAGTTT
ATGAAATAGAAATAGGTATTAAATCAGTAAAACCTGAGTATAGCAAATTATTAAAAGCTGGCCTATTGAA
CAAAGATATTCAAAATCAATTGATATATGATCAAAAGAAAATTAGCAATATTATTTGGCTTGGTGAAACA
TTTCATGGTTTAGATATTGAAGAAGCTCAGGCTTTATGTGAGTTTCTTGATGAAGAGAATATTAACCCGA
AAATTAATCCTATAAATTCTAAAAAGCTATATAAAACCTACAAAGAAAATTATAAAAGCGATTCAGAAAA
AATTTTAAGTTTCACAAAATACAAAGAGAAATATAATTTTTTAAATAATGATAAGCTTAGAGAAGAACAT
GCAAATAAACTTTCAAGCATATTAGAAGATCCAAAATTTAGAGTTCTTAGCTATATAAATGCATTTTTAT
GTTCAACTAAAAATTATCTAGTACCTTATGGGTATTTAGGAAGTAATCCTCTTACATACTATAATTGTAT
GCTAGAAACCGGAAAACGTAGAACATCAAAAGAAGCATATTTTGCTGATATAAGAAACAAATTGTTTATA
GTATGCTATCTTCCTGGCTTCTTGAGCTCTGTAATTGCTGATGATGACTTTATAGACTGGTATTCTAATA
AGAAAGAAAATCAAGAATTACTCAAAAACTCTTATTTGAACAATTTATATAACTCAAAGCAGAAATATAT
AAAAGATTTTATCGATCTTGATATTATTAAACTTCTAAAACAGACATCATCTCAAATCAAGCCAAGCTAT
ATACCAGTAGCTTTTAGATATGGTGCATTTGCCTCAACAACTGCTTTGATAAGATCAAATGCAAATGTTT
CTAATCGAATGGAGTTTGAATTATATGACTCACCTGAAAGACTACATAATCAATACTTAGAAAAAGAGGA
AATGATTATGCCAAAATCGGTTAATAACCCCAAGGATCACTCAATTGACAATGGAGTGTCTTTATTTAGC
CTTAATCTAACAAATGAAAAAGAAGATGGACTTCGAAAAGTTATGTTGAAAGTTGCACAACTATATAATC
TTGATTTCAAGGTAGGTATCTCAGGAAATTTAGATCAAGCAATGACTCAGGCATTAATACTCGGGATGGC
AACTACAAAAAAAAATGGAGATATCGTAATTGATGAAGATCAAGTGCTATATATGACATACTTATACTGC
ATTTTCATGGCACATAGTGTCGATCATACTGTAGATGAAATACTAATGTCCTCAAATACTTATATGTTAA
ATTCTAAAGAGGAAAAGTATCCTATAGCCAATATAGCTAATTTTTTTGCTAGACCTGTATTTAAACTTTC
TAAGGATAAAGAGTTTAAAGCATTAGTTGAAAAGTATGAAAATAGCATAAAACCTAATTCAAAAGTTCTC
AAAGAAAATTATATAAGTAGAGTAACGACGTTATCCGAGGTATATGAAGATATATATAATTTAAATTGCT
TATATAGTTCTCTATCAGAAGGATCCTTGTATAACCTATTATCAACTCATAGTGAAAGAAACTGTACTTT
ATTAGAGCAGTATTCTCGTAAGAAGAAAGCGGAGACAGGATTGGTCCAAGATGGAGAGAAAATAAAAGTC
GTAAACAACTACAATGGCTATGCTGCTATTAATCAATATCAACGTTTTGTATCACTAGGCATAATGTATG
ATAGTGGTGCAAAATACTCCTCTTCTCATAAAAAACAGATAGAAAAAGATTTCAACTTATACTCACCAGA
TAAAGAACAGATAAATTATCTAAAATATAACTTTAAAGATAATAAATTTGATGCTGTTTATAAAAACAAA
AAGAGCAAAGAAAAAACTCAAAGCCATATTGTGTATGCAAAAAAACAAAATACGCGATATTGCTACGGAT
ATTTTAACAATTTTTTCGTTAAAAATAGAATTACGACTTTTTATAAAATAAAAGATAAATCAGGAAACTA
TTTAGTAAACTTACATAATGAAAAATATAGTTTCGCAACACCTAATTCAGATTCTAAAATATATAGAGCT
TCACCAGAATTACTTAACAATAGAGATGATTTTAAAAGAGTATCTAAAGATATTATAAAATCATATAAAT
ATATTAGTTTTGATAAACAAAAGGAAGATATAGTTAAAAATTTTGGTAAAAACTTATATCATACTAATTA
TGAGATATGGGTCGGACTATCACATCAAGCTATATCATGTTTTTCAGTTTTAGATAACATAGATACACAA
GAAGCTGCTAATACTTTTATCGATGCTTTATATTATATTAGATTAATGCAATTATATTATGGCAAAACTA
TACCTTTTTTGTTGATTAGTAGCGAAATTGTAAGATATTCTTCATCAGAAACTCACTACTATATACCAAC
AGAAGAAAACTTTGAAAATATACTTAAAATTGCTCTTAATAGTGCCTCAAAACCAGTAATAGAAAGATTC
TTAATTATTCTTAACATATATAATAACACTATTGATGATAATACTTTAATTTTAATACGATGCCGTTTAA
CAATAATATTATTTGAACATGAAGAGCAGAAACTCAAATTAAAAGCTTTACAAAAATATGCTGACGCTTA
TAAAAAAAATAATTATAAAAACGAAATTAATTTTAGAGCTTGGTTTGAATCTATATTTCATGTTCAAAAC
TTATCCTTATCTCCTAATTATATTGGCAATAATATTTTAATCTTGAGTTTAGTTGAAGAATTAAAACCAA
AATGTAGTGAATATAAAAAAAACATGATTAACCAACAAATTATAGCTAAAGCAAACGAGTTAAACTTTTA
TCAACTTATAATAAGACTTATTGAAATATCAACCTATCATAGAATACTTACGAAATCAATCATAACTAAT
ACAACCTCGTTACTTTATGACATATTAAATAAACCAGAATTTCAAACAATAAATAAATCAATAAATAAGC
TATTTATTTATAAAAACAAGGATCTAAATACTGATAAATATAAAGCCTTTCACACTAAGCTTATAACTAT
TGAAAAAACCTATAAGAAAATAAATAGCTTATATAAATCAGACTTTTTTAAAAAAATATCATCATAG