SecReT6
Protein ID: 89256488
SecReT6 ID467
T6SS typeii
Gene symbol-
Locus tagFTL_1166
StrainFrancisella tularensis subsp. holarctica LVS
Repliconchromosome [GenBank: NC_007880] [Browse all T6SS(s) in this replicon]
Location [Strand]1108616..1110046 [-]
Producthypothetical protein
NoteIglH
UniProt IDQ2A352
KEGG IDftl:FTL_0120, ftl:FTL_1166
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 476 a.a.     [Download]
>gi|89256488|ref|YP_513850.1| hypothetical protein FTL_1166 [Francisella tularensis subsp. holarctica LVS]
MDEKRKDLSTSDASILKKTFDKLSNDIRDDFDKRIFDYSNALLFKYYSNLYYFVPKSCLLEINDKGHNGY
YIPPQEYFFIEDKRTGKTLTYTTKSENIILPIRDITTIKQSDTSINISLEFANNFDYDYVTIWIDPTLCK
EDPSFATYIFNQVLEDNGSAKIKFSNHSYTTKNVQIEPIKFQLKPTEKLVLNIHSPSLLYGFNIKIKDLF
KYKNNDLNKIDFFLEVKTENYNDEKLLSLFRVNLIPVFNSFDDYSSTSFASMNLSESKLKHHQKDDAQAI
EVLSVYENNKQCDFNSFLFVGQNEYYFNRSTQSLNYSSVLPQFSNKIIGTKIHTYTTWTQITEISDLIEI
NSNAIASISCNISPIVINKALNNYNSNAKEMFNIIDMIISKNMYSKTTFLAIAKLLKINTNDLTLLSMLL
QDVEMDSNINELILTLSDKYNPKYKHFLNFHIGIICKFINQNTFSFIKKIVLNNSI
 
Nucleotide Sequence: 1431 bp     [Download]
>gi|89255449|ref|NC_007880.1|:c1110046-1108616 Francisella tularensis subsp. holarctica LVS chromosome, complete genome
ATGGATGAAAAAAGAAAAGATTTAAGTACGAGTGATGCTAGCATCCTAAAAAAAACTTTTGACAAACTAA
GTAATGATATAAGAGATGATTTTGATAAGAGAATTTTTGATTATAGTAATGCTCTTTTATTCAAGTATTA
TAGTAACCTTTATTATTTCGTTCCTAAATCATGCTTATTAGAAATAAATGATAAAGGACACAATGGTTAC
TATATTCCACCTCAGGAATATTTTTTCATAGAAGACAAGAGAACAGGTAAAACTCTAACATATACGACAA
AGTCAGAAAATATAATACTCCCTATTAGAGATATCACAACCATAAAACAAAGTGATACATCAATAAATAT
ATCATTGGAATTTGCAAATAACTTTGACTATGATTATGTTACTATCTGGATAGATCCAACTTTATGTAAA
GAAGATCCTAGCTTTGCCACATACATATTTAACCAAGTATTAGAAGATAATGGCTCAGCAAAGATTAAAT
TTTCAAATCATAGTTATACAACAAAAAATGTACAAATAGAACCAATTAAGTTCCAATTAAAACCAACAGA
AAAGTTAGTTCTCAATATCCATTCTCCTAGCCTTTTATATGGTTTTAACATAAAGATCAAAGACTTATTT
AAATACAAAAATAATGACCTCAACAAAATTGACTTTTTTTTAGAAGTTAAAACTGAAAACTATAATGACG
AAAAATTATTATCTCTATTTAGAGTTAATTTAATACCTGTGTTTAATAGTTTTGATGATTACTCAAGCAC
CTCATTTGCTTCGATGAATCTCTCAGAGAGTAAACTAAAACATCATCAAAAAGATGATGCTCAAGCAATA
GAAGTATTATCTGTTTATGAGAATAATAAACAATGTGATTTTAATAGTTTTCTTTTTGTAGGACAGAATG
AGTATTATTTTAATCGCAGCACACAATCTTTAAATTATAGTAGCGTACTCCCTCAATTTAGTAATAAAAT
AATAGGAACAAAAATACATACATATACAACCTGGACACAGATAACTGAGATTTCTGATCTAATTGAAATT
AACTCAAATGCAATAGCATCTATAAGCTGTAATATTTCTCCAATAGTTATTAACAAAGCACTAAACAACT
ACAATAGCAATGCTAAAGAAATGTTTAATATAATAGATATGATTATCTCTAAGAATATGTATTCAAAAAC
AACATTCTTAGCTATAGCAAAGCTTTTAAAGATTAATACTAATGACTTAACTTTACTATCAATGCTCCTA
CAAGATGTTGAGATGGACTCTAATATAAATGAGCTAATTTTAACCTTAAGTGATAAATATAACCCAAAAT
ATAAACATTTCTTAAATTTTCATATTGGTATTATATGCAAATTTATAAATCAAAACACCTTTAGCTTTAT
TAAAAAGATTGTTTTAAATAACTCTATATAA