SecReT6
Protein ID: 89256492
SecReT6 ID467
T6SS typeii
Gene symbol-
Locus tagFTL_1170
StrainFrancisella tularensis subsp. holarctica LVS
Repliconchromosome [GenBank: NC_007880] [Browse all T6SS(s) in this replicon]
Location [Strand]1112824..1113201 [-]
Producthypothetical protein
NoteIglE
UniProt IDQ2A348
KEGG IDftl:FTL_1170, ftl:FTL_0124
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 125 a.a.     [Download]
>gi|89256492|ref|YP_513854.1| hypothetical protein FTL_1170 [Francisella tularensis subsp. holarctica LVS]
MYNKLLKNLCLVLSTIIGLSSCISDGLYINNNIPKTKIVLESKPDKNIFYSDNYQSISQRIYDDNVKVLN
LKTGKNEFPLDKDIKDYALYFILPENKKTENWKYIISSDSVNKFTIKNDSSIEKD
 
Nucleotide Sequence: 378 bp     [Download]
>gi|89255449|ref|NC_007880.1|:c1113201-1112824 Francisella tularensis subsp. holarctica LVS chromosome, complete genome
ATGTACAATAAATTATTGAAAAATCTTTGTTTAGTATTATCCACAATCATAGGGCTTAGCAGTTGTATTA
GTGATGGTTTGTATATCAACAACAATATTCCTAAGACAAAAATAGTTCTAGAATCTAAACCTGATAAAAA
TATTTTCTACTCAGATAACTATCAATCTATTTCTCAAAGAATATATGATGATAATGTAAAAGTATTAAAT
CTTAAAACAGGAAAGAATGAATTTCCATTAGATAAAGATATCAAGGATTATGCCTTGTATTTTATACTTC
CTGAAAATAAAAAAACTGAAAACTGGAAATACATAATAAGTTCAGATTCTGTAAATAAATTTACTATAAA
AAATGATAGTAGCATAGAAAAAGATTAA