SecReT6
Protein ID: 89256493
SecReT6 ID467
T6SS typeii
Gene symbol-
Locus tagFTL_1171
StrainFrancisella tularensis subsp. holarctica LVS
Repliconchromosome [GenBank: NC_007880] [Browse all T6SS(s) in this replicon]
Location [Strand]1113191..1116472 [-]
Producthypothetical protein
NotePdpB
UniProt IDQ2A347
KEGG IDftl:FTL_1171, ftl:FTL_0125
PDB IDNA
Domain hit(s) vs Pfam DUF1215 [PF06744], Evalue: 0.002, Aligned region: 847..939
Protein Sequence: 1093 a.a.     [Download]
>gi|89256493|ref|YP_513855.1| hypothetical protein FTL_1171 [Francisella tularensis subsp. holarctica LVS]
MNFIKNHQILIISLTIAIIVLSVLGIFMIKKWLKTSRNPNKKSASKTIKNAKSLIKKNKVKNNLSELYIF
YGDYLAAKDYITKIKPQAQIIDNNELPLIAIDKNNTSLVFANNEFSYLYKLKKKLNLQFYKLNFCFDISD
DYYHENIKISEIYKELLKLRLKNFIISFYTLSEHTRSYNNAIDKKSIFKLTSDADTNHKAEEEILSKILS
SKDDVNNKYNNVKILNQIRKLLKNIHPQLKSINKETFFNFGLNTPDNIIAKKDTIFFSSFPKSIIINLIS
LLFSFIFIVNIFQEINIKKKFSIQELNQLHESDSNKIIEETRKKIDEAILLDILYPKSIKYHFIYKQYAD
TLLKNVILPKYNDTYDLSMITSFLIFFEYLDNKIINQHTNRILKIISSITNLSEKQLDIVVKYTTPSIRT
EMIKSAINRANKLYTNRLIVVGKDSKSYLSTKGFNAEYLGISNTKRAKVINNIYIQYLYKCATDNAILDL
NDNYIIPIEVNNIFKMYQEQFDTSSKKLCNSSYINSITKSVSLILNQEENKRKFESFSDMLDHIYYLVKS
LEKNAKDVADDGKKQTSSITVSLINYVINSVVNPTYNKNELPLISPVSKNLYMEFAPNFYSKRILISPIY
SKEYIKDNIDPTNKKFNRLVNNLKNNFNIEPDFMIAIYKSSINNYIEKYIGSYNKMIDSLNNDSEFNKNI
SNKGALKLYLLAMSSKDSSFNSLIEFYSTNTDLITNESETNSSKKINKLQHFYGEITKLNKQNNTNDQND
KSLWAPIDNYFKENDKYLESKSYADYKNIFKQLNNLIIEQGYSSTYKNIKQGYEPLQKVYSELSKINNHQ
GNNNLYKLLKKHLDIAINTIKTIAIQDAITKLDNTVNIEYEYINNQFPFNKDSNSAATNEAITKDFDNNG
YIYSGFIEQLSPLLFYNKTDDRWESKDFSKPEEIDYLNKFNKVYLLNKLLWDDKINPKAIKFDITPIPNK
DNDYTFFSIILDKQNYVNSLNIKYSDSIEVLYNWNSLESTTITIKFEDGSNEQISYQGKWSILKAIKDAN
CDQNNICTWIIKHKGKKYPLSFKIESKFLQVLGWQKQGEVNVQ
 
Nucleotide Sequence: 3282 bp     [Download]
>gi|89255449|ref|NC_007880.1|:c1116472-1113191 Francisella tularensis subsp. holarctica LVS chromosome, complete genome
ATGAATTTTATTAAAAATCATCAAATATTAATAATTTCACTAACTATAGCAATAATTGTTTTATCAGTAC
TTGGTATTTTTATGATTAAAAAATGGCTTAAAACATCAAGAAATCCTAACAAAAAATCTGCCTCAAAGAC
CATAAAAAATGCGAAATCATTGATCAAAAAGAATAAAGTAAAAAACAACTTAAGTGAATTGTATATTTTC
TATGGGGACTATCTGGCAGCTAAAGATTATATAACAAAGATAAAACCTCAAGCTCAAATCATTGATAATA
ATGAACTCCCTTTAATAGCTATTGATAAAAACAATACATCTCTCGTATTTGCAAATAATGAATTTTCGTA
CCTATATAAGTTAAAAAAGAAACTAAATCTACAATTTTATAAGCTTAACTTTTGCTTCGATATATCCGAT
GATTACTATCATGAAAATATCAAAATTAGTGAAATCTATAAAGAACTATTAAAATTAAGATTAAAAAACT
TCATAATATCTTTTTACACCTTATCTGAGCATACTAGAAGCTATAATAATGCAATTGATAAAAAATCAAT
ATTTAAATTAACTTCTGATGCGGATACAAATCATAAAGCTGAAGAGGAAATATTATCAAAAATTCTTAGC
TCTAAAGATGATGTTAATAATAAATACAATAATGTTAAGATATTAAATCAAATAAGAAAGTTGCTAAAAA
ACATCCACCCTCAATTAAAATCTATAAATAAAGAAACATTCTTTAATTTTGGGCTAAACACACCAGATAA
TATCATAGCAAAGAAAGATACAATATTTTTTAGCAGCTTTCCAAAAAGTATTATCATAAACTTAATATCT
TTGTTATTTAGTTTTATATTTATCGTTAATATTTTTCAAGAAATTAATATTAAAAAAAAATTCTCTATAC
AAGAACTTAATCAACTACATGAAAGCGACTCTAATAAAATAATAGAAGAAACTAGAAAAAAAATTGATGA
GGCTATACTTCTAGATATCCTATATCCGAAATCGATAAAATATCATTTCATATACAAACAATATGCTGAT
ACTCTCCTAAAGAATGTAATCTTACCAAAATATAATGATACATATGACTTATCAATGATTACATCATTTT
TAATATTTTTTGAGTATTTGGATAACAAAATTATTAACCAACATACGAATAGAATACTTAAAATAATAAG
CAGTATCACCAACCTATCTGAAAAGCAGCTAGATATCGTGGTCAAGTATACGACCCCAAGTATAAGAACT
GAAATGATTAAGTCAGCCATCAACAGAGCAAATAAACTTTATACAAATCGTTTAATAGTTGTAGGTAAAG
ACTCCAAAAGTTACTTAAGTACTAAAGGATTTAATGCTGAATACTTAGGGATTTCAAATACTAAAAGAGC
GAAGGTCATAAATAATATTTATATACAATACCTATATAAATGTGCTACAGATAATGCAATTTTAGATTTA
AACGATAACTACATAATACCAATAGAAGTAAATAATATCTTCAAGATGTATCAAGAGCAATTTGACACAT
CCTCTAAAAAGCTATGTAACTCATCATATATTAACTCTATTACAAAGAGCGTTTCTTTGATACTTAATCA
AGAGGAAAATAAAAGAAAATTTGAAAGCTTCAGTGATATGCTAGACCATATCTATTATTTAGTAAAATCA
TTAGAAAAAAATGCTAAAGATGTCGCAGATGATGGTAAAAAACAAACTAGCTCGATAACAGTATCGCTTA
TAAATTACGTTATAAATAGTGTTGTCAACCCTACTTATAATAAAAATGAGCTCCCACTAATAAGTCCAGT
AAGTAAAAACCTATATATGGAGTTTGCTCCTAATTTCTATAGTAAAAGAATACTTATCTCTCCAATATAC
TCAAAAGAATATATTAAAGATAATATAGATCCTACAAATAAAAAGTTTAATAGACTCGTCAATAATCTAA
AGAATAACTTCAATATAGAACCCGACTTTATGATTGCTATCTATAAAAGCTCTATAAATAACTACATTGA
GAAATATATAGGATCCTATAATAAGATGATTGATAGCCTTAATAATGACTCTGAATTTAACAAAAATATA
TCTAACAAGGGTGCTCTTAAATTATATTTGCTAGCAATGTCATCAAAGGATTCTTCCTTTAATAGCCTAA
TAGAGTTTTATAGCACTAATACAGACCTAATAACTAATGAATCCGAAACCAATTCATCTAAAAAGATAAA
TAAGCTTCAACATTTTTATGGAGAAATAACTAAATTAAACAAACAAAATAATACTAATGATCAAAATGAT
AAGTCATTGTGGGCGCCTATAGATAACTACTTTAAAGAAAACGATAAATATCTTGAGTCTAAGAGTTATG
CCGACTATAAAAACATATTTAAACAGTTAAATAATCTAATAATAGAACAAGGCTATTCAAGTACATATAA
AAATATCAAACAAGGATATGAACCACTACAAAAAGTTTACTCTGAACTTTCTAAGATAAATAATCATCAA
GGTAATAATAACTTATATAAACTGTTGAAGAAACATCTAGATATTGCCATTAATACTATAAAAACTATCG
CCATACAAGATGCTATAACTAAACTTGATAATACTGTCAATATTGAGTACGAATACATAAATAATCAATT
CCCTTTTAATAAGGATAGTAACTCGGCTGCAACAAATGAAGCTATAACCAAAGACTTTGATAACAATGGT
TATATATACTCTGGATTTATAGAGCAACTATCTCCACTACTTTTTTATAATAAAACTGATGATAGATGGG
AAAGTAAAGATTTTTCAAAACCTGAGGAAATAGACTATCTAAATAAATTCAATAAGGTATATCTTTTAAA
TAAGCTACTATGGGATGATAAAATAAATCCAAAAGCTATAAAATTTGATATAACTCCTATACCAAACAAA
GATAATGATTATACATTTTTTAGCATAATCCTCGATAAGCAAAACTATGTAAACTCATTAAACATAAAAT
ATTCAGATAGTATTGAAGTTTTGTACAACTGGAATTCACTTGAGTCAACAACTATTACCATAAAATTTGA
GGATGGTAGTAATGAGCAAATAAGCTATCAAGGAAAATGGTCTATATTAAAAGCAATTAAAGACGCAAAT
TGTGATCAAAACAATATTTGTACCTGGATAATCAAGCACAAAGGTAAAAAATATCCTTTAAGCTTCAAAA
TAGAATCAAAATTCTTACAAGTATTAGGATGGCAAAAACAAGGAGAAGTCAATGTACAATAA