SecReT6
Protein ID: 90021170
SecReT6 ID119
T6SS typei5
Gene symbol-
Locus tagSde_1523
StrainSaccharophagus degradans 2-40
Repliconchromosome [GenBank: NC_007912] [Browse all T6SS(s) in this replicon]
Location [Strand]1964450..1965859 [-]
Producthypothetical protein
NoteTssL
UniProt IDQ21KJ4
KEGG IDsde:Sde_1523
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 7.30E-55, Aligned region: 81..282
OmpA [PF00691], Evalue: 6.00E-16, Aligned region: 351..449
Protein Sequence: 469 a.a.     [Download]
>gi|90021170|ref|YP_526997.1| unnamed protein product [Saccharophagus degradans 2-40]
MDNSDITVIKPRPGKRANAPQQSVTPSSDQTIIKPRPRPGGKRTPPTAAMGDTTVIKPRHPNQSATVDLK
FAAIENTHATTIAEAASPVLALATQLKQIQGKVDGQRLRNYVQESIKQFDSKITKLESDIQIRQDANYIL
CALIDETILNTTWGEMSGWSQHPILSIFHKETYGGEKFYRILDTSLESPYEHKDLLEILFVAMSLGFMGK
LRIDPQGPIKIEKIRSRLYDVLHRSREKYNNTLSVNISPQISNKQHLYSFLPAWLLIGTLVLAAFGLYSY
WLIGLNKESDTTRVLMTNLIPTPEKKVLDPSMVRPEFIELRALLTPEIDRGILSVQDYPTHTSIVLHNQE
LFTSGNINITPSFEPILDKIAKALEAIPGRIIVSGHTDNESIRTPRYPSNWHLSLARASEVVKYLAASAD
LKSRLLPEGRGANEPIMSNDTAAGRAHNRRVVIDVYYHQGLIASEQQAK
 
Nucleotide Sequence: 1410 bp     [Download]
>gi|90019649|ref|NC_007912.1|:c1965859-1964450 Saccharophagus degradans 2-40 chromosome, complete genome
ATGGACAACTCGGATATAACAGTAATTAAGCCTCGACCAGGAAAGCGAGCAAACGCGCCCCAACAAAGCG
TAACTCCGTCGTCGGATCAGACCATAATAAAGCCGCGCCCTCGCCCCGGCGGCAAGCGCACACCTCCCAC
TGCGGCAATGGGCGATACGACTGTTATAAAGCCTCGCCACCCAAACCAATCGGCAACTGTAGACTTAAAA
TTCGCAGCCATAGAGAACACACACGCAACAACAATTGCCGAGGCGGCATCCCCCGTTTTGGCGCTTGCGA
CTCAACTAAAGCAAATTCAAGGTAAAGTAGATGGCCAGCGCCTACGAAATTATGTGCAAGAGTCCATTAA
ACAGTTTGATAGCAAAATAACCAAACTTGAAAGCGATATTCAAATAAGGCAAGACGCCAACTATATACTG
TGCGCTCTTATTGACGAGACCATTCTAAATACCACTTGGGGTGAGATGTCTGGCTGGAGCCAACACCCTA
TACTCAGTATTTTTCACAAAGAAACCTACGGTGGAGAAAAATTCTACCGCATATTAGATACAAGCTTAGA
ATCCCCTTACGAGCATAAAGATTTACTAGAAATACTTTTTGTTGCAATGTCACTTGGTTTTATGGGAAAG
CTGAGAATAGACCCTCAAGGCCCTATAAAAATTGAAAAAATCCGTAGTCGTCTTTACGACGTACTACATA
GATCCAGAGAGAAATACAACAACACCCTATCGGTTAATATTTCTCCGCAAATCAGTAATAAGCAACACCT
ATACTCATTTTTACCTGCTTGGCTGTTAATCGGCACACTTGTGCTCGCCGCATTTGGCCTATACAGCTAT
TGGCTTATCGGCTTAAACAAAGAGTCGGACACAACGCGCGTACTAATGACTAACCTAATTCCCACGCCCG
AGAAAAAAGTACTCGACCCCAGTATGGTTCGGCCTGAATTTATCGAGCTGCGCGCTTTACTTACCCCAGA
AATAGACAGAGGTATTTTAAGTGTGCAGGACTACCCGACTCACACCTCGATAGTGCTGCACAACCAAGAG
CTTTTCACCTCTGGCAATATCAATATCACACCCTCTTTTGAGCCAATATTAGATAAAATAGCCAAGGCAC
TGGAAGCCATACCGGGCAGAATTATCGTATCTGGCCATACCGATAACGAATCTATTCGCACACCGCGCTA
CCCTTCTAACTGGCACCTCTCCCTTGCTCGCGCAAGTGAAGTGGTTAAGTACTTAGCTGCAAGTGCAGAC
CTTAAATCACGCCTACTACCTGAAGGACGCGGGGCTAACGAACCCATTATGAGTAACGACACCGCCGCTG
GGCGCGCCCACAATCGCCGTGTTGTTATCGACGTTTATTACCATCAAGGATTAATAGCTAGCGAACAGCA
AGCTAAATAG