SecReT6
Protein ID: 90021171
SecReT6 ID119
T6SS typei5
Gene symbol-
Locus tagSde_1524
StrainSaccharophagus degradans 2-40
Repliconchromosome [GenBank: NC_007912] [Browse all T6SS(s) in this replicon]
Location [Strand]1965894..1967231 [-]
Producthypothetical protein
NoteTssK
UniProt IDQ21KJ3
KEGG IDsde:Sde_1524
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 9.10E-155, Aligned region: 19..444
Protein Sequence: 445 a.a.     [Download]
>gi|90021171|ref|YP_526998.1| unnamed protein product [Saccharophagus degradans 2-40]
MVKHNKIAWMESQYLFPHHFQQQERYIEATIEHRAKAIRPFVWGFEALELDSTLLNEQRIALTRASGIMT
DGCPFDLPHNAPLPAPIQVDQQVKNELVYLVLPIYQAGSRYVESSNAGEGVARYRLQELEVFDYCSDNNN
AEQVESATLQFRLALEHENLGGFTCLPIARIAEVTQEGAIILDKKFIPPVLSVKANPLLQGYLSDIIGML
HQRGDLLSHRFNSGTQDNNSAAIADFMLLQLINGAEPALRHLNNIKKTHPETLYAKLVSLSGELATFTTK
SKRPVDFEPYKHNDLYKCYLPVIETLSKQLSVVLEQTAISLPMEKRQYGIYVSRITDRSLLSQSRFILAA
KANISTDQLRAHLPKHVKIGSVETIRDLVNNQLTGITLTNLAMAPREISYTAGFVYFELDAHGEQWQSLN
NSGGFAFHIAGDLPELAVEFWAIRN
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|90019649|ref|NC_007912.1|:c1967231-1965894 Saccharophagus degradans 2-40 chromosome, complete genome
ATGGTTAAGCACAACAAAATAGCGTGGATGGAAAGCCAATACTTATTCCCACACCACTTCCAGCAACAAG
AACGCTATATTGAAGCCACCATAGAGCACCGCGCGAAAGCGATTAGACCATTTGTATGGGGCTTTGAAGC
GCTCGAGCTTGACAGTACGCTACTAAACGAACAGCGCATTGCCCTCACACGTGCAAGCGGCATAATGACT
GATGGCTGCCCTTTCGATTTACCTCATAACGCACCACTGCCAGCTCCAATTCAAGTGGATCAGCAGGTAA
AAAATGAGCTTGTATACCTTGTACTGCCAATATACCAAGCGGGTTCGCGCTATGTTGAAAGCAGTAATGC
AGGGGAAGGTGTTGCACGATACCGGCTTCAAGAATTGGAAGTATTTGATTACTGTTCAGACAACAACAAT
GCTGAGCAAGTAGAAAGCGCCACATTACAGTTCAGGCTAGCACTAGAGCACGAAAACCTAGGTGGATTCA
CCTGCTTACCTATCGCGCGAATAGCGGAAGTCACGCAAGAAGGCGCCATAATTTTAGATAAGAAATTTAT
TCCACCTGTACTTTCTGTAAAAGCCAACCCGCTGCTTCAGGGTTACCTAAGTGACATTATTGGGATGCTG
CACCAACGCGGTGACTTACTCTCACATAGGTTTAATTCAGGCACTCAAGATAATAATTCTGCAGCTATAG
CCGACTTTATGTTATTACAACTTATTAATGGCGCAGAACCGGCTCTACGCCACTTGAACAATATTAAGAA
AACACACCCAGAAACCCTGTATGCCAAACTGGTATCTCTATCTGGAGAACTAGCGACATTTACAACAAAG
TCTAAGCGCCCAGTTGACTTTGAACCCTACAAGCATAACGACCTATACAAATGTTATTTGCCTGTAATCG
AAACCCTAAGTAAGCAGCTTAGCGTTGTATTAGAGCAAACCGCAATTTCTCTGCCGATGGAGAAGCGCCA
GTACGGTATTTATGTATCGCGCATTACCGACCGTTCGCTTCTATCTCAGTCACGATTTATTTTGGCCGCC
AAGGCTAATATCAGTACTGATCAACTGCGTGCCCACTTGCCAAAACATGTAAAAATTGGCTCCGTAGAAA
CCATTCGCGACTTGGTAAATAACCAGCTAACTGGTATCACCCTTACAAATCTCGCCATGGCACCTAGAGA
GATTTCTTATACCGCAGGGTTTGTGTATTTTGAGCTGGACGCTCACGGCGAACAATGGCAATCGCTCAAC
AACTCTGGTGGTTTCGCTTTTCATATTGCCGGCGATTTACCGGAACTAGCCGTAGAATTTTGGGCTATTC
GAAACTAA