SecReT6
Protein ID: 90021172
SecReT6 ID119
T6SS typei5
Gene symbol-
Locus tagSde_1525
StrainSaccharophagus degradans 2-40
Repliconchromosome [GenBank: NC_007912] [Browse all T6SS(s) in this replicon]
Location [Strand]1967303..1967797 [-]
Producthypothetical protein
NoteTssJ
UniProt IDQ21KJ2
KEGG IDsde:Sde_1525
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.10E-34, Aligned region: 14..145
Protein Sequence: 164 a.a.     [Download]
>gi|90021172|ref|YP_526999.1| unnamed protein product [Saccharophagus degradans 2-40]
MANIAIAVAVLIGFTGCAATNYIVSPYDKLTVIANKDVNPDGSGRPSPIQIKVYQLTSRTTLDNLDFDKL
FYRGEDFLSDELLEQKEFILQPKEELKHEIALVSGVTHIAVLAAYRDIDSTRWKHLYKINDTGYYSHKIM
VTQQGLVDVPKSQKKQQRRRRERD
 
Nucleotide Sequence: 495 bp     [Download]
>gi|90019649|ref|NC_007912.1|:c1967797-1967303 Saccharophagus degradans 2-40 chromosome, complete genome
GTGGCAAACATAGCTATTGCTGTGGCGGTACTTATTGGCTTCACCGGCTGCGCAGCAACAAACTATATAG
TATCTCCGTACGACAAGTTAACGGTAATAGCCAATAAAGACGTTAACCCAGATGGCAGTGGTAGACCCTC
CCCCATTCAAATTAAGGTATACCAACTTACATCTCGCACAACACTCGACAATTTAGATTTCGATAAATTA
TTTTATCGCGGGGAAGATTTCTTAAGTGACGAACTTCTGGAGCAAAAAGAATTTATTCTTCAACCCAAAG
AAGAGCTCAAGCACGAAATAGCCTTAGTTAGCGGCGTTACCCATATTGCTGTGCTCGCCGCCTACAGAGA
CATTGATTCTACGCGTTGGAAGCACCTATATAAGATAAATGATACCGGCTATTACTCACATAAAATAATG
GTCACTCAGCAAGGGCTCGTTGACGTTCCAAAATCTCAGAAGAAACAACAGCGACGGCGCAGAGAACGCG
ACTAA