SecReT6
Protein ID: 90021173
SecReT6 ID119
T6SS typei5
Gene symbol-
Locus tagSde_1526
StrainSaccharophagus degradans 2-40
Repliconchromosome [GenBank: NC_007912] [Browse all T6SS(s) in this replicon]
Location [Strand]1967820..1969016 [-]
ProductFHA domain-containing protein
NoteFha
UniProt IDQ21KJ1
KEGG IDsde:Sde_1526
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 5.40E-15, Aligned region: 29..97
FHA [PF00498], Evalue: 5.40E-15, Aligned region: 119..131
Protein Sequence: 398 a.a.     [Download]
>gi|90021173|ref|YP_527000.1| unnamed protein product [Saccharophagus degradans 2-40]
MALRIDVKNHDALDTNAPKFTLFGMDGGKLGRSSECELYLPCEEKSVSRVHAEIRLEDCAFLLIDRSING
VYINKSNEPLGMGKRHPIKHGDVFQIGNYELEANFDVEEDDIPAFAPSTNQANIVLDNNAVTTQPATSDI
ADARIDFGSTTDQFTPPTTIIPKDWDLDLASPELPAAKPEKAQVIDFSNKKSKLIESLLSGLAPESKFTA
DQITPETAQLLGKALRISLMGAVAQRRVLQEAKSKACLDEIPTERQMEADALGSFPNADSIIEALLDTRH
RDQKKIPSLLSATLKYNLEDQIELNAGYQAAITKAQQCLAPVEIEKALEKAHKAHAQKNSAIESLSSKFM
SQSKKWSFYTANWAKICEKASAQIGKDFETKTLLAHAKRMRDKNNATK
 
Nucleotide Sequence: 1197 bp     [Download]
>gi|90019649|ref|NC_007912.1|:c1969016-1967820 Saccharophagus degradans 2-40 chromosome, complete genome
ATGGCCTTACGAATAGATGTAAAAAATCATGATGCATTGGATACGAATGCACCTAAATTTACTTTGTTTG
GGATGGATGGCGGCAAGCTAGGAAGAAGCTCTGAGTGCGAATTATATTTACCTTGCGAGGAAAAATCCGT
ATCGAGAGTGCATGCAGAAATTCGCTTGGAAGACTGCGCATTTTTATTAATAGACCGTAGCATTAACGGC
GTTTATATCAACAAATCTAACGAGCCCTTAGGTATGGGCAAGCGCCACCCAATAAAACACGGCGATGTAT
TTCAAATTGGAAACTATGAATTAGAAGCCAATTTTGATGTGGAAGAAGACGATATACCAGCTTTTGCACC
AAGTACAAATCAAGCTAATATTGTTTTAGACAATAACGCAGTTACAACCCAACCCGCCACATCGGACATA
GCCGATGCCCGTATTGATTTTGGCTCGACCACCGATCAATTCACACCACCCACGACTATTATACCCAAGG
ACTGGGACCTAGATTTAGCATCCCCCGAACTACCTGCCGCAAAACCGGAAAAAGCCCAAGTTATAGATTT
TTCTAACAAAAAATCAAAACTAATAGAAAGCCTACTTAGCGGGCTAGCACCCGAGTCGAAATTCACCGCA
GACCAAATAACTCCCGAAACGGCCCAGTTGTTAGGCAAGGCATTACGCATTTCGCTGATGGGCGCTGTCG
CGCAGCGACGTGTATTACAAGAGGCTAAAAGCAAAGCTTGCCTAGACGAAATACCCACTGAACGCCAAAT
GGAAGCAGACGCTTTGGGCAGCTTTCCAAACGCGGATTCAATTATTGAAGCACTACTAGATACAAGGCAT
CGGGATCAGAAAAAAATACCGTCACTGCTAAGTGCAACACTTAAATACAACTTGGAAGATCAAATCGAGC
TCAACGCGGGCTATCAAGCAGCAATAACTAAAGCACAACAGTGTTTAGCCCCCGTGGAAATCGAAAAGGC
ACTAGAAAAAGCTCACAAGGCACACGCTCAAAAAAATAGCGCGATAGAAAGCCTTAGTAGTAAATTTATG
TCGCAATCTAAAAAGTGGAGTTTCTACACCGCAAATTGGGCAAAAATTTGCGAGAAAGCTAGCGCTCAAA
TAGGTAAAGACTTTGAAACTAAAACGCTGCTAGCCCACGCAAAACGTATGCGGGATAAAAACAATGCAAC
CAAATAA