SecReT6
Protein ID: 90021175
SecReT6 ID119
T6SS typei5
Gene symbol-
Locus tagSde_1528
StrainSaccharophagus degradans 2-40
Repliconchromosome [GenBank: NC_007912] [Browse all T6SS(s) in this replicon]
Location [Strand]1971811..1972926 [+]
Producthypothetical protein
NoteTssA
UniProt IDQ21KI9
KEGG IDsde:Sde_1528
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.50E-18, Aligned region: 67..128
Protein Sequence: 371 a.a.     [Download]
>gi|90021175|ref|YP_527002.1| unnamed protein product [Saccharophagus degradans 2-40]
MELFNSNEELSAMLEPLQEGEPVGQDLRENISPTSSYQVLRDARTLARNNERAALASGESMYFHMPDWTL
ILEKVPEVLKTESKDIELVAWYIEGLTRFHGFAGLASGFSIARQLIASFGEALYPRPDEDGIATQLAPLI
GLNGFGSEGALIAPIKSIPITQGDYPGPLATWECEQAFELARITDPDKREARLKQGGVSREALDQVVAQT
STEFLQKMHADISAAIYEFELFQQQIDAYCPNDPQPTGKIKEALKACLQTFQYIAGDRIQSEASEVEAMQ
EQEETGGQPAADSQVNLNAKIVDRQHALKLLREVADFFRKTEPHSPISYSVEQTIRWSSLPLTELIKELI
PEESARKKYQNLSGMSMSGQD
 
Nucleotide Sequence: 1116 bp     [Download]
>gi|90019649|ref|NC_007912.1|:1971811-1972926 Saccharophagus degradans 2-40 chromosome, complete genome
ATGGAATTGTTTAACTCTAATGAAGAATTGTCTGCCATGCTTGAGCCTTTGCAAGAGGGGGAGCCTGTCG
GGCAAGATTTACGCGAGAATATCTCACCAACATCTAGCTACCAAGTACTTCGCGATGCCCGCACGCTAGC
AAGAAATAATGAGCGTGCTGCGTTAGCGAGTGGCGAAAGTATGTACTTTCATATGCCAGATTGGACGCTA
ATTCTCGAAAAAGTGCCTGAGGTTTTAAAGACAGAAAGTAAAGATATAGAACTAGTAGCTTGGTATATAG
AAGGTTTAACTCGGTTTCACGGTTTTGCTGGGCTTGCTTCAGGTTTTAGTATTGCTAGGCAGCTTATAGC
AAGCTTTGGCGAAGCATTGTACCCGCGGCCAGATGAGGATGGCATTGCTACACAGCTGGCACCACTTATA
GGTTTGAACGGGTTCGGTTCGGAAGGCGCCTTGATTGCCCCGATTAAATCTATACCCATTACTCAGGGAG
ATTACCCTGGCCCACTAGCCACGTGGGAGTGTGAACAAGCCTTTGAGTTAGCTCGAATTACTGACCCTGA
CAAGCGTGAAGCTCGACTAAAGCAGGGCGGAGTATCTCGCGAGGCATTGGATCAGGTTGTTGCGCAAACC
AGTACTGAATTTTTGCAGAAAATGCATGCAGATATAAGCGCAGCAATCTATGAGTTTGAGTTGTTTCAAC
AGCAGATAGATGCATACTGCCCGAATGATCCTCAGCCAACCGGTAAAATTAAAGAAGCATTAAAAGCCTG
CTTGCAAACATTCCAATATATTGCTGGCGATAGAATTCAAAGTGAGGCCAGTGAAGTCGAGGCTATGCAA
GAGCAGGAAGAAACCGGCGGGCAACCCGCTGCCGATTCGCAGGTTAACCTAAATGCAAAAATTGTCGATC
GGCAGCATGCGTTGAAGTTATTGCGAGAGGTTGCAGACTTTTTTAGAAAAACCGAACCACATTCCCCTAT
ATCTTACTCGGTTGAGCAAACGATACGTTGGAGCTCGTTACCGCTTACAGAGCTTATTAAAGAATTGATC
CCAGAAGAGTCCGCAAGAAAAAAATATCAGAACCTTTCTGGAATGTCGATGAGTGGGCAAGATTAG