SecReT6
Protein ID: 90021176
SecReT6 ID119
T6SS typei5
Gene symbol-
Locus tagSde_1529
StrainSaccharophagus degradans 2-40
Repliconchromosome [GenBank: NC_007912] [Browse all T6SS(s) in this replicon]
Location [Strand]1973009..1973512 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ21KI8
KEGG IDsde:Sde_1529
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 8.40E-61, Aligned region: 8..162
Protein Sequence: 167 a.a.     [Download]
>gi|90021176|ref|YP_527003.1| unnamed protein product [Saccharophagus degradans 2-40]
MESIHKKLSRVRKPRVHISYDVETEGATVQKELPFVVGVMGDFSGDPTAPLKALKDRRFVQIDRDNFDEV
LKSMTPGLSIQVNNTLKNDGSQFAVDLKFESMDDFEPGAIVNQVEPLKKLLDTRNKLRDLSTKADRSEEL
EGILERILNNEADLGELAEAVGADKES
 
Nucleotide Sequence: 504 bp     [Download]
>gi|90019649|ref|NC_007912.1|:1973009-1973512 Saccharophagus degradans 2-40 chromosome, complete genome
ATGGAAAGCATACATAAAAAGTTAAGTCGAGTTAGAAAGCCTCGGGTTCACATTAGTTACGATGTGGAAA
CCGAAGGGGCTACAGTACAAAAGGAATTGCCATTTGTTGTAGGCGTAATGGGCGATTTTTCTGGCGACCC
AACTGCACCGTTAAAAGCGTTAAAAGATCGCCGGTTTGTGCAGATAGACCGAGATAATTTTGATGAAGTG
CTTAAAAGCATGACTCCAGGATTGTCAATTCAAGTAAATAACACCTTGAAAAACGACGGCAGCCAATTCG
CGGTAGATTTGAAATTTGAATCTATGGATGACTTTGAACCAGGCGCCATTGTGAACCAGGTAGAGCCACT
TAAAAAATTGTTGGATACGCGTAATAAATTACGCGACTTATCAACCAAAGCAGACCGTTCTGAAGAATTA
GAAGGCATTTTAGAGCGTATATTGAATAACGAAGCTGATCTTGGCGAATTAGCCGAAGCGGTTGGCGCAG
ACAAGGAGTCCTAA