SecReT6
Protein ID: 90021177
SecReT6 ID119
T6SS typei5
Gene symbol-
Locus tagSde_1530
StrainSaccharophagus degradans 2-40
Repliconchromosome [GenBank: NC_007912] [Browse all T6SS(s) in this replicon]
Location [Strand]1973515..1974990 [+]
Producthypothetical protein
NoteTssC
UniProt IDQ21KI7
KEGG IDsde:Sde_1530
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 4.90E-191, Aligned region: 63..487
Protein Sequence: 491 a.a.     [Download]
>gi|90021177|ref|YP_527004.1| unnamed protein product [Saccharophagus degradans 2-40]
MSDAVAEAQEGAVETQTLSLLDQAIQATKQTDTEEAQALLKTLTEEALKGTVSWNKNLMVTFNKAIEAID
KAISEQLREIMHNESFQKLEGTWRGMHYLVNNSETSTSLKIKLLNASKKEVAKDLSKAVEFDQSQVFKKL
YENEFGTPGGEPYGALIGDFEFTNHPDDIELLSGMSNVAAAAFCPFLSAADPKLFGFDKWNELSKPRDLS
KIFDSAEYTKWRSFRDSDDSRFVSLAMPRVLARLPYGETTKPVEAFSYEELPDGEKPLLNQYCWSNAAYV
LGARLTDAFAQYGWCTAIRGAEGGGRVNDLPVHLSTTDDGDIDMQCPTEIAVTDRREAELSSLGFMPLSH
YKNTDYAVFFGGQTTQRPRVYAQPEATANAAISARLPYIMATSRIAHYLKVMARDKVGSFMESDDMQHWL
NRWINGYVNASEEGGQDMRAQYPLREAKIEVKPVPGKPGSYNAVAWLRPWLQMEELSTSLRMVARIPEIG
G
 
Nucleotide Sequence: 1476 bp     [Download]
>gi|90019649|ref|NC_007912.1|:1973515-1974990 Saccharophagus degradans 2-40 chromosome, complete genome
ATGAGTGATGCAGTTGCAGAAGCCCAAGAAGGCGCAGTAGAAACCCAAACCTTAAGCCTGTTGGATCAAG
CTATTCAAGCTACCAAACAAACAGACACAGAAGAAGCTCAAGCCCTGTTAAAAACCTTAACAGAGGAAGC
GCTTAAGGGAACCGTTAGCTGGAATAAAAACTTGATGGTCACCTTTAACAAGGCCATTGAAGCAATCGAC
AAAGCAATTAGTGAGCAGTTGCGAGAAATTATGCACAACGAAAGTTTCCAGAAGTTAGAGGGAACTTGGC
GTGGCATGCACTACTTGGTAAACAACAGTGAAACCAGCACTTCTTTAAAAATAAAATTACTAAATGCAAG
TAAAAAGGAAGTGGCTAAAGATCTTTCTAAAGCTGTTGAATTCGACCAAAGCCAAGTATTTAAAAAGCTA
TACGAAAATGAATTTGGTACTCCCGGTGGTGAGCCATATGGCGCGTTGATCGGCGATTTCGAATTCACTA
ATCATCCCGATGATATTGAGCTGTTAAGCGGTATGTCTAACGTTGCGGCTGCTGCATTTTGTCCGTTCCT
ATCTGCCGCCGACCCGAAACTATTTGGCTTTGATAAGTGGAACGAACTTTCCAAACCACGCGATTTAAGC
AAGATATTCGACTCTGCTGAATACACCAAATGGCGCTCTTTCCGCGATTCTGACGACTCGCGTTTTGTGA
GTTTGGCCATGCCGCGTGTTCTTGCGCGTTTGCCCTATGGCGAAACCACAAAGCCTGTAGAGGCGTTTAG
CTACGAAGAATTACCAGACGGTGAAAAGCCTCTTTTGAATCAATATTGTTGGTCTAACGCAGCATATGTA
CTCGGTGCGCGCTTAACTGACGCATTCGCACAATACGGCTGGTGTACAGCTATTCGTGGTGCAGAAGGCG
GTGGTCGAGTAAATGATTTGCCTGTGCATTTGTCTACTACCGATGATGGCGATATCGATATGCAATGTCC
TACCGAAATTGCTGTTACCGATCGTCGTGAGGCCGAGCTTAGCTCTTTAGGGTTTATGCCTTTGTCTCAC
TACAAAAATACTGACTACGCCGTTTTCTTTGGTGGGCAAACTACTCAGCGTCCTCGTGTATACGCTCAGC
CAGAAGCAACCGCCAATGCAGCTATTTCTGCGCGTTTGCCTTACATAATGGCTACTTCTCGTATTGCTCA
TTACTTGAAAGTTATGGCTCGCGATAAAGTGGGTAGTTTTATGGAATCTGACGATATGCAGCATTGGCTA
AACCGTTGGATTAACGGCTATGTAAACGCGAGCGAAGAAGGCGGGCAAGATATGCGTGCGCAATACCCGC
TTCGCGAAGCTAAAATTGAAGTTAAGCCCGTACCAGGCAAGCCCGGTTCATATAATGCCGTTGCGTGGTT
GCGCCCTTGGCTGCAAATGGAAGAGTTGAGCACTTCTTTACGAATGGTTGCTCGCATACCAGAGATTGGT
GGCTAG