SecReT6
Protein ID: 90021178
SecReT6 ID119
T6SS typei5
Gene symbol-
Locus tagSde_1531
StrainSaccharophagus degradans 2-40
Repliconchromosome [GenBank: NC_007912] [Browse all T6SS(s) in this replicon]
Location [Strand]1975157..1976710 [+]
Producthypothetical protein
NoteTssC
UniProt IDQ21KI6
KEGG IDsde:Sde_1531
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.90E-162, Aligned region: 74..508
Protein Sequence: 517 a.a.     [Download]
>gi|90021178|ref|YP_527005.1| unnamed protein product [Saccharophagus degradans 2-40]
MTNYSENIEAESLEQSVDYAIETPEVEEGGIPSLLLHCFNSASNNVQDSDIDDWVYRSLVTKNITSKDAA
IYLIEKTILEIDKILCAQIDEILHHERFRALEASWRGVIHLIDTQSDYDEELTVKIKVLNVGWKEVGKDL
ARAIEFDQSQLFQRIYSDEFDTPGGEPFGVLLGDYYVSHRHRAGSLYNDLDTLKELANIATAALCPFITG
AHASLFGLDSAREMGYPIDLQAVFKQKEYLRWKSLRQTESTRFVGLTLPEMLMREPYRADGTRAENFNYN
ERTLNADSDYVWGNACFAFGSVLIRAFANTGWFADIRGGVHEFGEGGVVRGMRYSRFETDISNNAAQPTT
KLQIDDYLERELSDLGFIPMCSYFGSEISAFYSNSSLHDPAEYTTEIAKTNARLSAMIQYMLCVSRFGHY
LKVIGRDRIGSIISAQDCQRVFQNWLNQYTTSSEGASNVLKARYPLSESRVEIHEQPGRIGYFTCVVHLK
PHFQLDQLVSSIKLVTELAVGTVGSQH
 
Nucleotide Sequence: 1554 bp     [Download]
>gi|90019649|ref|NC_007912.1|:1975157-1976710 Saccharophagus degradans 2-40 chromosome, complete genome
GTGACTAACTATTCGGAAAACATAGAGGCAGAATCGCTGGAGCAATCAGTGGACTATGCAATCGAGACGC
CGGAAGTGGAAGAAGGGGGAATACCATCTTTACTGCTGCACTGTTTTAATAGCGCGTCGAACAATGTACA
AGATTCGGATATTGACGATTGGGTTTATCGGTCGTTAGTGACCAAAAACATCACTTCTAAAGACGCTGCC
ATTTATCTTATTGAAAAGACTATTTTGGAAATAGATAAGATATTGTGCGCTCAAATAGATGAAATATTAC
ATCACGAAAGATTTCGCGCACTTGAGGCGAGTTGGCGCGGAGTAATTCATTTAATTGATACCCAATCCGA
TTACGATGAAGAGCTTACAGTAAAAATTAAAGTATTAAATGTTGGTTGGAAAGAGGTTGGTAAAGATTTA
GCTCGTGCAATTGAATTTGATCAAAGCCAGTTGTTTCAGCGAATATACAGTGATGAATTCGACACCCCAG
GCGGTGAACCTTTTGGCGTGCTGCTTGGCGACTATTATGTTTCTCACAGGCATAGAGCCGGCTCGCTTTA
CAATGATTTAGACACACTTAAAGAGCTTGCAAATATTGCAACAGCGGCCCTGTGCCCGTTTATCACCGGC
GCGCATGCATCTTTATTTGGCTTAGATAGCGCAAGAGAAATGGGTTACCCGATTGATTTACAGGCCGTTT
TTAAACAAAAAGAGTATTTACGCTGGAAGTCATTACGCCAAACAGAGTCGACACGTTTTGTAGGGTTAAC
ATTACCTGAAATGTTAATGCGTGAGCCCTACCGGGCCGACGGAACCCGAGCAGAAAACTTTAATTACAAC
GAGCGTACGCTGAATGCAGATAGCGATTATGTGTGGGGTAATGCCTGTTTTGCGTTCGGTAGTGTACTTA
TAAGAGCTTTCGCTAATACGGGGTGGTTTGCAGATATTCGTGGTGGCGTGCACGAGTTTGGAGAAGGCGG
TGTAGTACGAGGCATGCGCTATTCGCGTTTCGAAACAGATATCTCCAATAATGCGGCGCAACCTACAACC
AAACTACAAATAGATGATTATTTAGAGCGCGAGCTGAGCGATCTTGGGTTTATCCCCATGTGTAGTTACT
TTGGTTCGGAAATTAGCGCTTTTTACAGCAATAGCTCGCTCCATGACCCAGCAGAATACACCACAGAAAT
TGCCAAAACTAATGCTCGTTTATCGGCAATGATCCAATACATGCTCTGCGTTTCTCGGTTTGGCCACTAT
TTAAAAGTCATTGGTCGAGACCGTATAGGTAGCATTATTAGTGCGCAAGATTGCCAACGTGTATTTCAAA
ACTGGTTGAATCAATACACAACTTCTAGTGAAGGGGCGTCGAATGTTTTAAAGGCGCGTTATCCACTGTC
AGAGAGTCGTGTGGAAATTCATGAGCAACCAGGGCGTATTGGTTATTTTACCTGCGTTGTACATTTAAAA
CCCCATTTTCAGCTAGATCAACTTGTGTCTAGCATTAAATTAGTAACCGAACTGGCAGTGGGAACTGTTG
GCTCTCAACATTAA