SecReT6
Protein ID: 90021179
SecReT6 ID119
T6SS typei5
Gene symbol-
Locus tagSde_1532
StrainSaccharophagus degradans 2-40
Repliconchromosome [GenBank: NC_007912] [Browse all T6SS(s) in this replicon]
Location [Strand]1976725..1977558 [+]
Producthypothetical protein
NoteTagJ
UniProt IDQ21KI5
KEGG IDsde:Sde_1532
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 4.80E-37, Aligned region: 138..258
Protein Sequence: 277 a.a.     [Download]
>gi|90021179|ref|YP_527006.1| unnamed protein product [Saccharophagus degradans 2-40]
MATASEEYSAGNIQAALAAIAEEIKASPSDAKKRAFFIELLCIAGEYERADQQLNTLVVLDPQSAITVGT
WRQLIRAAQTRMDVYQNNAVPDVIDQPTPVIAKSLELLVALNADDATQAAAALEQLEKVVKPLCLNVNGK
AVEHWRDLDDVNAYVLELLGTNGKYFWIDYAQIESVEFDQPARPLDMLWRKVTITLKSGSVGEAFVPAVY
PYKTEDDAAKLGRLTQWHEQCGLSRGEGLRTWLLGDEALTVFEVNNITASNSDQNSNETSIASEAVN
 
Nucleotide Sequence: 834 bp     [Download]
>gi|90019649|ref|NC_007912.1|:1976725-1977558 Saccharophagus degradans 2-40 chromosome, complete genome
ATGGCTACGGCAAGCGAAGAATATTCAGCAGGAAATATACAAGCAGCACTTGCTGCGATTGCAGAAGAGA
TAAAAGCGTCGCCATCGGATGCTAAAAAGCGTGCTTTTTTTATAGAGCTGCTATGTATTGCAGGTGAATA
CGAACGAGCAGATCAACAACTAAATACATTGGTCGTGCTAGACCCGCAATCAGCCATTACCGTGGGCACT
TGGCGACAGCTAATTAGGGCTGCGCAGACGCGTATGGATGTTTACCAGAATAATGCTGTGCCTGATGTTA
TCGATCAGCCTACGCCTGTTATTGCCAAATCCTTAGAATTGTTAGTGGCGTTAAATGCTGACGATGCTAC
CCAAGCTGCAGCTGCATTGGAGCAGTTAGAAAAAGTAGTTAAACCACTTTGTTTGAACGTAAATGGGAAA
GCTGTAGAGCATTGGCGTGACCTAGACGATGTAAACGCGTATGTGTTGGAGCTATTGGGCACCAACGGAA
AATACTTTTGGATTGATTACGCGCAAATTGAATCTGTTGAATTTGACCAGCCTGCACGCCCATTAGATAT
GCTGTGGCGGAAAGTGACCATTACTCTAAAAAGCGGTAGCGTTGGCGAAGCATTTGTGCCAGCTGTATAC
CCCTATAAAACAGAAGATGATGCTGCGAAACTCGGTCGTTTAACCCAATGGCACGAGCAGTGTGGCTTGA
GCCGAGGTGAGGGTTTGCGAACTTGGCTACTAGGGGATGAGGCATTAACAGTATTTGAAGTAAATAACAT
TACTGCTAGCAATAGTGACCAAAACTCAAATGAAACGTCTATAGCCTCTGAAGCTGTTAATTAA