SecReT6
Protein ID: 90021180
SecReT6 ID119
T6SS typei5
Gene symbol-
Locus tagSde_1533
StrainSaccharophagus degradans 2-40
Repliconchromosome [GenBank: NC_007912] [Browse all T6SS(s) in this replicon]
Location [Strand]1977562..1978059 [+]
Producthypothetical protein
NoteTssE
UniProt IDQ21KI4
KEGG IDsde:Sde_1533
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.80E-20, Aligned region: 38..142
Protein Sequence: 165 a.a.     [Download]
>gi|90021180|ref|YP_527007.1| unnamed protein product [Saccharophagus degradans 2-40]
MARIRTDLPVLPSLLDRLIDDDPDRSLEAVKPAGVVLADIKANIRRDLENLLNTRIYRQLSIDAYPELQK
SLVNYGIKDFSHVQFDSDEERIQFAWSIRRAIEDYEPRFQWVQVDIEPFGEDFQRTLYLKISATLLIEPD
PVPLIFDSRVRTTDRALKLREVNHG
 
Nucleotide Sequence: 498 bp     [Download]
>gi|90019649|ref|NC_007912.1|:1977562-1978059 Saccharophagus degradans 2-40 chromosome, complete genome
ATGGCGAGAATACGAACAGATTTACCGGTGTTGCCTTCTCTATTGGATCGTTTAATTGACGATGATCCGG
ATAGAAGTTTGGAGGCGGTAAAACCCGCAGGAGTTGTGTTGGCAGATATAAAAGCAAACATTCGTCGGGA
CCTCGAAAATCTGTTGAATACTCGCATTTATCGCCAGCTAAGTATTGATGCTTACCCAGAGCTACAAAAG
TCGCTTGTTAACTACGGAATAAAAGATTTTAGTCATGTTCAGTTTGATTCGGATGAAGAGCGAATACAGT
TTGCTTGGTCTATTCGTCGAGCTATTGAAGACTACGAGCCGCGATTTCAATGGGTGCAAGTTGATATAGA
GCCATTTGGTGAAGATTTTCAGCGAACCTTATATTTAAAAATATCTGCAACATTGTTAATAGAGCCAGAC
CCAGTGCCCCTAATATTTGATTCAAGAGTTCGTACAACCGATAGAGCCCTCAAGTTGAGGGAGGTAAATC
ATGGATGA