SecReT6
Protein ID: 90021181
SecReT6 ID119
T6SS typei5
Gene symbol-
Locus tagSde_1534
StrainSaccharophagus degradans 2-40
Repliconchromosome [GenBank: NC_007912] [Browse all T6SS(s) in this replicon]
Location [Strand]1978052..1979887 [+]
Producthypothetical protein
NoteTssF
UniProt IDQ21KI3
KEGG IDsde:Sde_1534
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.20E-165, Aligned region: 5..611
Protein Sequence: 611 a.a.     [Download]
>gi|90021181|ref|YP_527008.1| unnamed protein product [Saccharophagus degradans 2-40]
MDDTLLSYYNRELSYVRKLGAEFSEQHPKIAGRLRLDSETVEDPHVSRLIESFAFLTARIRQTIDDSFPE
LTEALMGVLYPEFHAPYPAMSIAQIRVIRKTPSPQTIECGRKLHVKGEGYGDCVFSTCNELEALPVTIEN
TRVVNAPAKAPNLVLPGKERLLVKSVLSFDVKPFESAKVAEFKNDSLSLYIDGQSQLTFKLFEYLMQGTL
GITIAKSAMDPNPICLPANRLVASGLLRNGEVYGDSFDGRTCVTYKKIMDFFAFPKRFLFIDLVGMREIW
PLFESGFSVYFYFDETDPELVQGVDETTLQLGCVPIVNLYEGRIEYIGAKEVNLESKLEVHRSLADYADV
HHVSRVYAKNNEGETKELLPFYGSHRQAHSTDSPVYWGLRRENTRFDNGRVSAGTDTYISFVDTKFEVVN
LQSDWLIGADVICNNRDVAAKLPFGSELPHTDFIEGGAGMRVKLTIPATSTISPKLKSATRWQLIAQLTL
QSFAGKDGLGVLKESLRLYDLVGTRESQSMIDGIINMHTSPSTARIVQQGRSAICQGTKIELEFDEQFYS
GSSVVLFGHILDEFFAQFCAINSFTQLSIKIKQKPGRLIECPPRIGFQQLI
 
Nucleotide Sequence: 1836 bp     [Download]
>gi|90019649|ref|NC_007912.1|:1978052-1979887 Saccharophagus degradans 2-40 chromosome, complete genome
ATGGATGATACTTTACTTTCCTATTACAATAGGGAACTTAGTTACGTACGTAAATTGGGCGCTGAATTTT
CAGAGCAACATCCCAAAATTGCAGGCAGGCTTAGATTAGATAGTGAAACGGTGGAAGATCCACATGTTTC
TCGATTGATCGAATCATTTGCATTTTTAACTGCACGCATACGGCAAACAATTGACGACAGTTTCCCTGAG
TTAACAGAAGCGTTAATGGGAGTGCTGTACCCAGAATTTCATGCCCCGTACCCCGCAATGAGTATTGCTC
AGATTCGAGTAATAAGAAAAACTCCTTCTCCACAAACCATAGAATGTGGGCGCAAACTACATGTAAAAGG
GGAGGGTTACGGGGATTGTGTTTTTTCTACTTGTAACGAACTAGAAGCACTTCCCGTTACGATCGAAAAT
ACAAGGGTTGTAAATGCTCCAGCAAAGGCGCCAAATTTGGTTTTACCTGGCAAGGAGCGATTGCTGGTAA
AGTCAGTACTTTCATTTGATGTTAAACCATTTGAAAGTGCAAAAGTTGCTGAGTTTAAAAACGACTCTTT
AAGCTTGTATATCGATGGGCAGTCTCAACTAACGTTTAAGTTATTTGAGTATTTGATGCAAGGTACCCTA
GGTATTACTATTGCAAAAAGTGCTATGGACCCCAACCCAATTTGTTTACCTGCAAATCGCTTAGTTGCGA
GCGGGCTGCTACGCAATGGTGAGGTGTATGGTGATAGCTTCGACGGTAGAACTTGCGTAACCTATAAAAA
AATAATGGATTTCTTTGCGTTTCCAAAGCGATTTCTTTTTATCGATTTGGTAGGCATGAGGGAAATATGG
CCCTTGTTTGAATCGGGCTTCAGCGTGTATTTTTATTTCGATGAAACAGACCCTGAGCTGGTGCAAGGGG
TAGATGAGACAACCCTTCAGCTGGGTTGCGTGCCTATCGTTAACCTTTATGAAGGTCGCATAGAGTACAT
CGGTGCAAAAGAAGTGAATCTGGAGTCGAAGCTGGAAGTGCATCGATCTCTCGCAGATTACGCAGATGTA
CATCATGTTAGCCGAGTGTACGCCAAAAATAATGAAGGTGAAACGAAAGAGCTTTTGCCTTTCTATGGTT
CTCATCGTCAAGCACATTCAACAGATTCCCCTGTTTATTGGGGCTTGCGACGAGAAAATACTCGCTTTGA
CAATGGCCGGGTAAGTGCCGGTACCGATACCTACATTTCGTTTGTCGATACTAAATTCGAAGTGGTTAAC
CTGCAAAGCGACTGGCTTATTGGAGCAGATGTTATTTGTAATAATCGCGACGTAGCGGCAAAACTGCCGT
TCGGCTCTGAATTGCCACATACCGATTTTATCGAAGGTGGGGCCGGAATGCGTGTAAAACTCACTATACC
GGCTACATCGACTATATCGCCTAAACTTAAGTCGGCCACAAGGTGGCAACTTATTGCGCAGCTTACACTG
CAGAGCTTCGCCGGCAAAGATGGGCTGGGTGTACTAAAAGAAAGTTTACGTTTATACGATTTAGTGGGTA
CTCGAGAATCTCAATCAATGATTGACGGCATTATCAATATGCATACCTCACCGAGTACCGCGCGCATTGT
TCAGCAGGGCCGATCCGCGATATGCCAAGGTACCAAGATAGAGTTGGAGTTCGACGAGCAATTTTACAGT
GGCAGTAGTGTTGTGCTGTTTGGTCATATTCTCGATGAGTTTTTTGCTCAGTTTTGTGCAATAAATAGCT
TTACTCAGTTGTCTATTAAAATAAAACAAAAACCCGGAAGGTTAATAGAATGTCCGCCACGGATAGGTTT
TCAGCAGCTTATATAA