SecReT6
Protein ID: 90021182
SecReT6 ID119
T6SS typei5
Gene symbol-
Locus tagSde_1535
StrainSaccharophagus degradans 2-40
Repliconchromosome [GenBank: NC_007912] [Browse all T6SS(s) in this replicon]
Location [Strand]1979911..1980900 [+]
Producthypothetical protein
NoteTssG
UniProt IDQ21KI2
KEGG IDsde:Sde_1535
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 9.00E-78, Aligned region: 4..312
Protein Sequence: 329 a.a.     [Download]
>gi|90021182|ref|YP_527009.1| unnamed protein product [Saccharophagus degradans 2-40]
MDKNISFFFLVSLLERAHQCAQQQASSVVGQLGSDSQPQDESLRFKTKYDLAFRASSIASVKPAAGEGGG
VINKYLVVVNFIGLAGAAGVLPLHYTRLIMDRLKQRDKAMADFLDIFHHRLVSLFYRAWQKYKFTAQYEA
SLVLGKKDVFSTVIESLAGVSEQERFELQSYYAGHFAKKVRTVSSLRAVLMDYFGLPVEVNSFKGQWLQI
EKRDQFCLSSKAKKQRLGAGILLGKRCWDVQSKIEIDVGPMSLEQYQRKGPGTEFFKSARKLMNRFLPAH
INADMHFKVENKADFSLPLGKGLRLQRNGWLKSTKKDPLIATVSINRNE
 
Nucleotide Sequence: 990 bp     [Download]
>gi|90019649|ref|NC_007912.1|:1979911-1980900 Saccharophagus degradans 2-40 chromosome, complete genome
ATGGATAAAAATATAAGTTTTTTCTTTTTAGTTAGCTTGCTGGAGCGGGCGCATCAATGCGCGCAACAGC
AGGCAAGCTCTGTTGTGGGGCAGTTGGGTAGTGACAGCCAACCACAGGATGAATCCCTTCGGTTTAAAAC
TAAATACGACCTTGCTTTTAGAGCTTCCTCCATTGCCAGTGTTAAGCCTGCAGCGGGTGAGGGCGGCGGT
GTAATAAATAAGTATTTGGTGGTTGTTAATTTTATTGGGCTTGCCGGCGCTGCAGGAGTGTTGCCTTTAC
ACTACACGCGTTTAATTATGGATCGTCTTAAACAACGCGATAAGGCAATGGCCGACTTTTTGGATATTTT
TCATCATAGATTGGTATCGCTATTTTATCGAGCCTGGCAAAAATATAAGTTTACAGCGCAATACGAAGCT
AGCTTGGTGCTAGGAAAGAAGGACGTATTTAGCACTGTTATAGAAAGCTTGGCTGGAGTTAGTGAGCAAG
AGCGTTTTGAGTTACAGAGCTACTACGCTGGGCATTTTGCCAAAAAAGTTCGCACGGTTAGCTCCCTACG
AGCTGTTCTGATGGATTATTTTGGGTTGCCAGTAGAGGTGAATAGTTTTAAAGGGCAGTGGCTGCAAATA
GAAAAGCGCGATCAGTTTTGCCTTTCTTCTAAGGCTAAAAAGCAACGACTTGGTGCAGGCATATTACTAG
GTAAAAGATGTTGGGATGTGCAAAGTAAAATTGAGATAGACGTAGGCCCTATGTCTCTCGAGCAATATCA
ACGAAAAGGGCCTGGTACAGAATTTTTTAAAAGTGCCCGTAAACTTATGAACCGGTTTTTGCCGGCGCAC
ATTAATGCTGATATGCATTTCAAAGTGGAGAATAAGGCCGACTTTAGTCTGCCGCTTGGAAAAGGATTAC
GCCTGCAGCGCAACGGTTGGTTAAAAAGCACTAAAAAAGACCCACTTATCGCTACGGTATCAATTAATAG
GAACGAGTGA