SecReT6
Protein ID: 90021183
SecReT6 ID119
T6SS typei5
Gene symbol-
Locus tagSde_1536
StrainSaccharophagus degradans 2-40
Repliconchromosome [GenBank: NC_007912] [Browse all T6SS(s) in this replicon]
Location [Strand]1980897..1983590 [+]
Productfibronectin, type III
NoteTssH
UniProt IDQ21KI1
KEGG IDsde:Sde_1536
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.00E-43, Aligned region: 225..247
AAA_2 [PF07724], Evalue: 1.00E-43, Aligned region: 504..528
AAA_2 [PF07724], Evalue: 1.00E-43, Aligned region: 611..778
AAA [PF00004], Evalue: 5.70E-20, Aligned region: 226..358
AAA [PF00004], Evalue: 5.70E-20, Aligned region: 617..737
AAA_5 [PF07728], Evalue: 1.70E-15, Aligned region: 226..248
AAA_5 [PF07728], Evalue: 1.70E-15, Aligned region: 299..356
AAA_5 [PF07728], Evalue: 1.70E-15, Aligned region: 616..740
ClpB_D2-small [PF10431], Evalue: 2.60E-13, Aligned region: 784..855
AAA_16 [PF13191], Evalue: 8.40E-11, Aligned region: 204..248
AAA_16 [PF13191], Evalue: 8.40E-11, Aligned region: 270..304
AAA_16 [PF13191], Evalue: 8.40E-11, Aligned region: 519..576
AAA_16 [PF13191], Evalue: 8.40E-11, Aligned region: 614..640
AAA_16 [PF13191], Evalue: 8.40E-11, Aligned region: 681..709
AAA_22 [PF13401], Evalue: 2.20E-08, Aligned region: 225..319
AAA_22 [PF13401], Evalue: 2.20E-08, Aligned region: 360..390
AAA_22 [PF13401], Evalue: 2.20E-08, Aligned region: 514..534
AAA_22 [PF13401], Evalue: 2.20E-08, Aligned region: 615..639
AAA_22 [PF13401], Evalue: 2.20E-08, Aligned region: 678..697
Sigma54_activat [PF00158], Evalue: 4.50E-08, Aligned region: 211..305
Sigma54_activat [PF00158], Evalue: 4.50E-08, Aligned region: 614..742
Clp_N [PF02861], Evalue: 8.20E-07, Aligned region: 35..82
Clp_N [PF02861], Evalue: 8.20E-07, Aligned region: 119..132
AAA_14 [PF13173], Evalue: 1.40E-06, Aligned region: 14..36
AAA_14 [PF13173], Evalue: 1.40E-06, Aligned region: 226..360
AAA_14 [PF13173], Evalue: 1.40E-06, Aligned region: 569..583
AAA_14 [PF13173], Evalue: 1.40E-06, Aligned region: 615..703
NACHT [PF05729], Evalue: 1.10E-05, Aligned region: 226..253
NACHT [PF05729], Evalue: 1.10E-05, Aligned region: 616..643
IstB_IS21 [PF01695], Evalue: 1.40E-05, Aligned region: 210..249
IstB_IS21 [PF01695], Evalue: 1.40E-05, Aligned region: 616..642
IstB_IS21 [PF01695], Evalue: 1.40E-05, Aligned region: 727..747
AAA_25 [PF13481], Evalue: 1.60E-05, Aligned region: 226..286
AAA_25 [PF13481], Evalue: 1.60E-05, Aligned region: 373..393
AAA_25 [PF13481], Evalue: 1.60E-05, Aligned region: 612..636
AAA_25 [PF13481], Evalue: 1.60E-05, Aligned region: 678..700
AAA_17 [PF13207], Evalue: 2.00E-05, Aligned region: 226..289
AAA_17 [PF13207], Evalue: 2.00E-05, Aligned region: 616..654
AAA_19 [PF13245], Evalue: 4.90E-05, Aligned region: 226..247
AAA_19 [PF13245], Evalue: 4.90E-05, Aligned region: 614..639
Zeta_toxin [PF06414], Evalue: 7.50E-05, Aligned region: 144..204
Zeta_toxin [PF06414], Evalue: 7.50E-05, Aligned region: 226..250
Zeta_toxin [PF06414], Evalue: 7.50E-05, Aligned region: 452..509
Zeta_toxin [PF06414], Evalue: 7.50E-05, Aligned region: 608..657
Arch_ATPase [PF01637], Evalue: 0.00051, Aligned region: 8..30
Arch_ATPase [PF01637], Evalue: 0.00051, Aligned region: 205..307
Arch_ATPase [PF01637], Evalue: 0.00051, Aligned region: 615..654
RNA_helicase [PF00910], Evalue: 0.0008, Aligned region: 227..248
RNA_helicase [PF00910], Evalue: 0.0008, Aligned region: 617..641
RNA_helicase [PF00910], Evalue: 0.0008, Aligned region: 720..735
SRP54 [PF00448], Evalue: 0.0011, Aligned region: 129..186
SRP54 [PF00448], Evalue: 0.0011, Aligned region: 226..248
SRP54 [PF00448], Evalue: 0.0011, Aligned region: 615..650
DUF2075 [PF09848], Evalue: 0.0013, Aligned region: 226..328
DUF2075 [PF09848], Evalue: 0.0013, Aligned region: 616..655
DUF258 [PF03193], Evalue: 0.0017, Aligned region: 221..246
DUF258 [PF03193], Evalue: 0.0017, Aligned region: 614..640
CbiA [PF01656], Evalue: 0.0053, Aligned region: 228..399
CbiA [PF01656], Evalue: 0.0053, Aligned region: 620..639
AAA_29 [PF13555], Evalue: 0.0055, Aligned region: 218..242
AAA_29 [PF13555], Evalue: 0.0055, Aligned region: 614..627
AAA_18 [PF13238], Evalue: 0.0077, Aligned region: 226..253
AAA_18 [PF13238], Evalue: 0.0077, Aligned region: 472..509
AAA_18 [PF13238], Evalue: 0.0077, Aligned region: 618..649
Protein Sequence: 897 a.a.     [Download]
>gi|90021183|ref|YP_527010.1| unnamed protein product [Saccharophagus degradans 2-40]
MTLLDNLKEMTMEFEKLVKNLSNESKELFEKSIALASSRSHFYIDVEHWLTEALAEEQREIIAILKHFNV
DVDRVHADLDLALENTKTGNDGFPKISPDIVRLLFEAWMIASSQYASVQVLPVHILLALVDSAGLKTKIG
KISKQFEAISGEEIRTQCETLLRGEALQDQGEATNKKLTKTPSLDQFTTNLTQQAKDGKIDSILGRDDEI
RQIIDVLCRRKQNNPILTGEAGVGKTAVVEGLAVKIAQGDVPTAIENVEIRSLDLGLLQAGAGVKGEFEN
RLKNVIKEVQQSVQSIILFIDEAHTLIGAGNQAGSGDAANLLKPALARGELRTIAATTWAEYKKYFESDA
ALTRRFQVVKVEEPSVDKAIIMLRNAAPTLEQHHKVVILDAAVSASVNLSHRYIPGRQLPDKCVSLLDTA
CARVNLSQNTTPARIVQYSQEIKNIEFEIERLNQEAEKGYEHSASIVELEVKKVGITERYQSLCARWEQE
KQIINQINSAREKAEEKVQDSDNEESATDLTNTLIAELRVKLKSISGSQPLIYECVDEQVVAEVVADWTG
IPVGRMQSDEIQNVLSLEQTMEKRVIGQSHGLKLISKAVQTARAKLSDPKRPLGVFMLVGPSGVGKTETA
LTLAEQLYGSEQNMTVINMSEFKEEHKVSMLMGSPPGYVGYGEGGVLTEAVRRKPYSVVLLDEMEKAHPG
VQDIFYQVFDKGILRDGEGRDIDFKNTVIIMTSNTASAQIEQLCIDPETKPEPKALLEAIEGTLRETYKP
AFLGRINLIPYYPLDEQCLSEIAVMQLHAIQQRVETNYKVELNYSDKLVEHVVSLCAQSDTGARKISALL
NNTLLPVLAEKILTEIALDKALESVEVDVSEEGEFVVKINSKKENTDDMKIKKTVTG
 
Nucleotide Sequence: 2694 bp     [Download]
>gi|90019649|ref|NC_007912.1|:1980897-1983590 Saccharophagus degradans 2-40 chromosome, complete genome
GTGACGCTACTCGATAATTTAAAGGAAATGACAATGGAATTTGAAAAGTTAGTTAAAAACCTATCGAATG
AAAGCAAAGAGCTATTCGAGAAATCTATTGCGTTGGCGTCTTCGCGCTCGCACTTTTATATTGATGTTGA
GCACTGGCTTACCGAAGCTCTTGCAGAGGAACAGCGTGAAATAATAGCGATATTGAAACACTTTAACGTC
GATGTGGATCGCGTGCATGCGGATTTGGATTTGGCGCTAGAGAACACAAAAACAGGGAATGATGGGTTTC
CTAAAATATCGCCAGACATTGTGCGGCTATTGTTTGAAGCTTGGATGATCGCTTCCAGTCAGTATGCGTC
TGTGCAGGTTTTACCCGTGCATATATTGTTGGCGCTAGTAGATAGTGCTGGTCTTAAAACAAAAATTGGT
AAAATATCTAAACAATTCGAGGCTATTAGTGGTGAAGAAATTCGCACTCAGTGCGAAACCTTGTTGCGCG
GTGAAGCGCTGCAAGACCAGGGTGAAGCTACTAACAAAAAATTAACTAAAACACCCAGCTTAGATCAGTT
CACAACAAACCTTACTCAGCAAGCCAAGGATGGGAAAATAGACTCAATTCTTGGGCGTGATGACGAAATA
AGACAGATCATCGATGTACTGTGCAGAAGAAAACAGAACAACCCCATTTTAACGGGGGAGGCTGGTGTTG
GTAAAACAGCTGTTGTAGAAGGTTTGGCCGTTAAAATTGCGCAGGGGGATGTTCCCACTGCGATAGAAAA
TGTAGAAATTAGAAGTTTAGATTTAGGCTTACTACAAGCAGGGGCTGGAGTAAAGGGCGAGTTCGAAAAC
AGGCTTAAGAATGTAATTAAAGAGGTACAGCAGTCTGTACAGTCCATAATTTTGTTTATCGATGAGGCTC
ATACACTTATTGGTGCGGGCAATCAGGCCGGTAGCGGAGATGCTGCCAATCTATTAAAGCCTGCTTTGGC
GCGCGGTGAGTTGCGCACAATAGCAGCAACTACCTGGGCCGAGTACAAAAAGTATTTTGAATCAGATGCC
GCACTTACTCGGCGCTTTCAGGTTGTGAAAGTAGAGGAGCCGAGTGTAGATAAAGCCATTATTATGCTTC
GCAATGCTGCTCCAACCTTAGAGCAACATCACAAGGTAGTAATACTTGACGCCGCGGTTAGCGCTTCGGT
TAATTTATCCCACCGCTACATTCCTGGTCGTCAACTACCTGATAAGTGTGTAAGCCTACTCGATACCGCC
TGCGCGCGTGTAAATCTTAGTCAAAACACCACGCCTGCTCGAATTGTTCAATATTCACAGGAAATAAAAA
ACATTGAGTTTGAAATTGAGCGGTTAAATCAAGAAGCTGAAAAAGGTTACGAGCACTCAGCGAGTATTGT
TGAACTTGAAGTTAAAAAGGTAGGTATTACCGAGCGCTACCAAAGCCTATGCGCGAGATGGGAACAAGAA
AAGCAGATAATTAATCAAATTAATAGTGCGCGTGAAAAGGCTGAGGAAAAAGTACAGGATTCTGATAATG
AAGAAAGTGCGACTGATTTAACAAATACGTTAATAGCAGAGTTGCGCGTCAAATTAAAAAGTATTTCTGG
TAGTCAGCCTCTAATTTATGAATGCGTAGATGAGCAGGTTGTAGCAGAGGTTGTAGCTGACTGGACAGGA
ATACCCGTTGGCCGTATGCAAAGTGACGAGATTCAAAATGTATTGTCGCTAGAGCAAACAATGGAAAAAC
GTGTGATTGGGCAGAGTCACGGCTTAAAGCTTATTTCTAAAGCTGTTCAAACTGCAAGAGCGAAACTAAG
TGACCCTAAGCGGCCATTAGGCGTATTTATGTTGGTTGGCCCAAGTGGTGTGGGTAAAACAGAAACGGCA
CTAACCTTAGCTGAACAGTTATACGGATCAGAACAAAATATGACCGTCATTAACATGTCAGAATTTAAAG
AGGAGCATAAGGTATCTATGCTTATGGGGTCGCCCCCCGGTTATGTTGGATATGGCGAGGGTGGCGTGCT
TACCGAAGCCGTCAGACGCAAGCCCTATAGTGTTGTGCTATTAGACGAAATGGAAAAGGCGCATCCAGGC
GTACAAGATATTTTTTATCAGGTTTTTGATAAGGGTATTTTGCGAGACGGCGAAGGTAGAGATATAGATT
TTAAAAATACTGTAATAATAATGACAAGTAATACAGCCAGCGCTCAAATAGAACAACTGTGCATCGACCC
CGAAACTAAGCCCGAGCCAAAAGCATTGCTTGAAGCAATAGAGGGTACCTTGCGTGAAACATATAAACCT
GCCTTTTTGGGGCGTATCAATTTGATTCCATACTACCCGCTAGATGAGCAGTGTTTATCTGAAATTGCGG
TAATGCAATTACATGCTATTCAGCAACGAGTGGAAACTAATTATAAAGTTGAGCTGAATTATTCAGATAA
ACTTGTTGAGCATGTTGTGTCATTGTGTGCGCAATCCGACACTGGAGCACGAAAAATATCTGCCTTGTTA
AATAACACTTTGCTGCCAGTGTTGGCAGAGAAAATACTTACCGAGATAGCATTGGATAAGGCTTTGGAGT
CTGTTGAGGTAGATGTAAGCGAAGAAGGGGAATTTGTTGTTAAAATAAATTCAAAAAAAGAAAATACAGA
CGACATGAAAATTAAAAAAACGGTAACTGGATAA