SecReT6
Protein ID: 90021184
SecReT6 ID119
T6SS typei5
Gene symbol-
Locus tagSde_1537
StrainSaccharophagus degradans 2-40
Repliconchromosome [GenBank: NC_007912] [Browse all T6SS(s) in this replicon]
Location [Strand]1983718..1984206 [+]
Producthistidine kinase
NoteTssD
UniProt IDQ21KI0
KEGG IDsde:Sde_1537
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 8.90E-34, Aligned region: 4..138
Protein Sequence: 162 a.a.     [Download]
>gi|90021184|ref|YP_527011.1| unnamed protein product [Saccharophagus degradans 2-40]
MSIFVNYEGIKGESSDSGHKGWMDVEAVSWGVGRNITSNSSTQGDRESSNAVISDLHVTRYMDSSTPKLF
IESCCGTGKEVKIHLSKTGSGSGADVYMEYTLKNALISSYSVNAVSQDNHRPTETFTITFVDVEVKYTPY
DEDGNAEAAIAVGFDTASNVKR
 
Nucleotide Sequence: 489 bp     [Download]
>gi|90019649|ref|NC_007912.1|:1983718-1984206 Saccharophagus degradans 2-40 chromosome, complete genome
ATGTCTATTTTTGTAAATTATGAAGGAATCAAAGGTGAGTCTTCAGATAGCGGCCATAAAGGATGGATGG
ACGTTGAAGCCGTTTCGTGGGGAGTTGGTCGTAACATTACCTCTAACAGTTCTACACAGGGCGATAGAGA
GTCTTCTAACGCTGTAATCAGTGATTTGCACGTTACTCGCTACATGGATAGCTCTACTCCAAAGCTATTT
ATCGAGTCATGTTGTGGTACTGGTAAAGAAGTAAAAATTCACCTAAGCAAAACAGGTTCTGGCTCTGGTG
CAGACGTGTATATGGAATACACTTTGAAAAATGCACTTATCAGCAGCTACTCTGTAAACGCTGTTAGTCA
AGACAATCATCGTCCTACCGAAACTTTCACCATTACATTCGTTGATGTTGAAGTTAAGTACACTCCGTAC
GACGAAGATGGCAATGCTGAAGCTGCTATTGCAGTTGGCTTCGATACCGCATCTAACGTTAAGCGTTAA