SecReT6
Protein ID: 90021185
SecReT6 ID119
T6SS typei5
Gene symbol-
Locus tagSde_1538
StrainSaccharophagus degradans 2-40
Repliconchromosome [GenBank: NC_007912] [Browse all T6SS(s) in this replicon]
Location [Strand]1984325..1986190 [+]
Producttwo component LuxR family transcriptional regulator
NoteTssI
UniProt IDQ21KH9
KEGG IDsde:Sde_1538
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.10E-52, Aligned region: 33..341
Phage_base_V [PF04717], Evalue: 6.60E-26, Aligned region: 103..118
Phage_base_V [PF04717], Evalue: 6.60E-26, Aligned region: 372..463
DUF2345 [PF10106], Evalue: 2.30E-05, Aligned region: 564..619
Gp5_C [PF06715], Evalue: 0.00017, Aligned region: 508..525
Gp5_C [PF06715], Evalue: 0.00017, Aligned region: 527..544
Gp5_C [PF06715], Evalue: 0.00017, Aligned region: 547..559
PvlArgDC [PF01862], Evalue: 0.00022, Aligned region: 9..123
Protein Sequence: 621 a.a.     [Download]
>gi|90021185|ref|YP_527012.1| unnamed protein product [Saccharophagus degradans 2-40]
MANAESTQDKNLVRVSTVLPDNALIATRLSISETLSEGFSIVVTAFSEKRHDLTAEDLVGTPLTAVLVQQ
DNSLRYFNGYIQEITATGSERAGQRSTYKLTVVSWLQLLSGKRRDNRIFQEKNVKQIIEEVFKPLGSIAD
YKFDISGEHPEWRYCTQYDETDLNFFNRLCQREGLAYYFLHDNGAHKLHIVDVANIRSLADNKPKIVEIQ
AGTPAFDHFSHWQSTGKFVAGTYTQRTYNYLKPTQLIEGSEKIKGDALKIPKVTDIEYYSYSEQFHTSEE
GKGSVSTKGHGASQAVISQGAGNCRHLKVGHTIQVALPGAANFADKGKEFTLTNVTINADDTSGVMNCFV
EALPKGNLLFPASSTPTINSLQTAVVTGPKGEEIHTDQLGRIKAQFHWDRAGKKDENSTCWLRVMQGFAG
NNYGAHFTPRIGHEVVVAFENGNPDRPFVIGSLFHQEHKPPYSEQLGSRSGVRTRSTKGGGETNFNELYF
EDTKGKEEVYFQAEKDLNAVVKNDETREVGNDQTSAIKHDRKMDVGNDHTETIKNKQTITVGKDQQNNIK
NNQITEVGKKSVHKVGKELVLEAGSKIILKVGGSSIEITGSKIAINSSGQVDVDGGKVKLN
 
Nucleotide Sequence: 1866 bp     [Download]
>gi|90019649|ref|NC_007912.1|:1984325-1986190 Saccharophagus degradans 2-40 chromosome, complete genome
ATGGCCAACGCTGAATCTACGCAAGATAAAAATCTAGTTAGAGTTAGTACTGTATTACCCGATAATGCAC
TAATTGCAACGCGTTTATCTATTTCTGAAACCCTGTCGGAAGGTTTTTCTATTGTTGTGACGGCCTTTTC
TGAGAAGCGTCACGATTTAACTGCAGAAGATTTAGTTGGAACGCCCCTCACTGCAGTGTTAGTTCAGCAA
GATAACTCTTTGCGCTATTTTAACGGCTATATTCAAGAAATTACTGCTACTGGCAGTGAACGAGCAGGGC
AAAGAAGTACTTATAAGCTAACGGTTGTGTCTTGGTTGCAGTTGTTGTCGGGAAAGCGCAGGGATAATCG
TATTTTCCAAGAGAAAAATGTTAAACAGATTATAGAAGAAGTGTTCAAGCCCTTAGGGTCTATCGCAGAT
TACAAATTCGATATTAGTGGCGAGCACCCAGAGTGGCGCTACTGTACACAATACGATGAAACAGATCTAA
ATTTCTTTAATCGGTTGTGTCAAAGAGAAGGGCTGGCCTACTATTTTTTACATGATAATGGCGCCCATAA
ACTGCATATCGTCGATGTGGCTAATATTCGTTCCCTTGCGGATAACAAGCCTAAAATAGTCGAGATTCAA
GCTGGTACACCAGCTTTTGATCATTTCTCTCATTGGCAAAGTACTGGTAAGTTTGTTGCTGGCACGTATA
CACAGCGAACATATAATTATTTAAAGCCTACGCAGTTAATTGAAGGCTCGGAAAAAATTAAAGGCGATGC
GCTTAAAATCCCAAAAGTTACGGATATAGAGTACTACTCCTATAGCGAGCAATTTCATACCTCGGAAGAG
GGTAAGGGTAGCGTATCTACAAAAGGTCATGGTGCCAGTCAGGCTGTGATTTCGCAGGGAGCGGGCAACT
GTAGGCATTTAAAAGTTGGCCATACTATACAAGTGGCTCTGCCTGGTGCGGCAAACTTCGCCGATAAAGG
CAAAGAGTTTACTTTAACGAATGTTACTATTAATGCAGACGACACCTCTGGTGTAATGAATTGCTTTGTA
GAAGCGTTACCTAAAGGAAATTTATTATTTCCGGCCAGCTCTACCCCAACCATTAATAGCTTACAAACGG
CGGTGGTAACTGGGCCAAAAGGCGAAGAAATACATACCGATCAATTAGGTCGAATTAAAGCACAGTTTCA
CTGGGACCGAGCCGGTAAAAAGGATGAAAACTCAACCTGTTGGCTAAGGGTGATGCAGGGCTTTGCTGGG
AACAATTATGGTGCCCACTTTACACCTCGAATCGGCCACGAAGTGGTTGTGGCGTTTGAAAACGGCAACC
CAGATAGACCATTTGTTATAGGGTCATTGTTTCACCAAGAGCATAAGCCACCGTATTCTGAGCAGCTTGG
CTCGCGTTCTGGAGTAAGAACCCGTTCTACCAAAGGTGGTGGCGAAACAAATTTTAACGAGTTGTACTTC
GAGGACACCAAGGGTAAAGAAGAAGTCTATTTCCAAGCAGAAAAAGACTTAAACGCTGTTGTAAAAAACG
ATGAAACGCGTGAGGTTGGCAACGATCAAACATCCGCAATAAAACACGATCGTAAAATGGATGTTGGTAA
CGACCATACTGAAACAATTAAAAATAAGCAGACTATCACTGTTGGTAAAGATCAACAAAACAATATTAAG
AATAATCAAATTACAGAAGTAGGCAAAAAAAGCGTACACAAGGTGGGTAAAGAGTTAGTCTTGGAAGCGG
GCAGTAAAATTATTCTTAAGGTTGGTGGCAGCTCTATTGAAATTACCGGCAGTAAAATCGCGATTAATTC
GTCTGGTCAAGTGGATGTTGATGGTGGAAAAGTAAAGTTGAACTAA