SecReT6
Protein ID: 91209286
SecReT6 ID120
T6SS typei1
Gene symbol-
Locus tagUTI89_C0238
StrainEscherichia coli UTI89
Repliconchromosome [GenBank: NC_007946] [Browse all T6SS(s) in this replicon]
Location [Strand]243926..245368 [-]
Producthypothetical protein
NoteTssA
UniProt IDQ1RFX3
KEGG IDeci:UTI89_C0238
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 2.60E-45, Aligned region: 119..184
DUF3702 [PF12486], Evalue: 2.60E-45, Aligned region: 286..299
DUF3702 [PF12486], Evalue: 2.60E-45, Aligned region: 316..462
ImpA-rel_N [PF06812], Evalue: 9.20E-21, Aligned region: 69..129
Protein Sequence: 480 a.a.     [Download]
>gi|91209286|ref|YP_539272.1| hypothetical protein UTI89_C0238 [Escherichia coli UTI89]
MWIPKITRSPAVCSACSVYRIRCIKGIVMSNYALTQTIVTGSDPRALPEFSAIREEINKANHPSQPELNW
KLVESLALSIFKANGVDLHTATYYTLARTRNQGLAGFCEGAELLAAMIIHEWDKFWPQSGPARTEMLDWF
NTRTGNILRQQVSFSENDLSLLYRTERALQLICDKLQQVELKRQPRVENLLYFVQNTRKRFEPQPRNRTD
TAAQTMVRTLVYAPEGTASATAETMPPLPDLPEMRVGVRGVADNADKAKQGDTVKGFVAGAACTAVIASA
LWWWQAYPMQQQLTQVRDTTQGAATVWLASPVLKEYEQYLQQLLNAPPLQPLETGMQMMRTADTLWPESL
QQQEASRMWSNTLRNRAQASPQMKGWQQARQNLRDFADLMMKKETEKQGFTLSYIKTVTWQAERLLNQET
PLEYLLTQYQETRTQKQDTQALEKEINERLDGLLSRWLLLKNTGQDMATDNRTEPVHPTH
 
Nucleotide Sequence: 1443 bp     [Download]
>gi|91209055|ref|NC_007946.1|:c245368-243926 Escherichia coli UTI89 chromosome, complete genome
ATGTGGATACCGAAGATAACCCGTTCACCGGCGGTCTGTTCAGCCTGTTCCGTTTACCGGATACGTTGTA
TTAAGGGGATAGTGATGAGCAATTACGCACTGACACAAACTATCGTTACCGGCAGCGATCCGCGCGCCCT
GCCGGAGTTCAGCGCCATCCGCGAAGAAATTAACAAAGCTAACCACCCGTCACAGCCGGAGCTGAACTGG
AAACTGGTGGAATCGCTGGCGCTGTCGATTTTTAAGGCCAACGGGGTGGATTTGCATACCGCCACCTACT
ATACGCTGGCACGTACACGTAATCAGGGACTGGCAGGGTTCTGTGAAGGCGCGGAACTGCTGGCTGCGAT
GATCATCCACGAATGGGATAAATTCTGGCCGCAGAGTGGTCCGGCGCGGACTGAGATGCTGGACTGGTTC
AACACCCGCACCGGGAATATCCTGCGCCAGCAGGTTTCCTTTTCCGAAAATGATCTTTCGTTGCTCTACC
GCACGGAACGGGCTTTGCAGCTTATCTGCGACAAACTCCAGCAAGTGGAACTGAAGCGCCAGCCGCGCGT
GGAAAATCTGCTTTATTTTGTGCAGAACACACGCAAGCGGTTTGAGCCGCAGCCCAGAAACCGTACTGAT
ACGGCGGCACAGACCATGGTCAGAACGCTGGTCTATGCGCCTGAAGGCACGGCTTCCGCCACAGCGGAAA
CCATGCCCCCCCTACCCGACCTGCCGGAAATGCGGGTGGGGGTGCGCGGTGTGGCAGATAACGCCGACAA
AGCAAAACAGGGCGACACGGTAAAAGGTTTTGTTGCCGGTGCCGCCTGTACTGCCGTTATCGCATCTGCA
CTCTGGTGGTGGCAGGCGTATCCGATGCAGCAGCAGCTTACACAGGTCAGGGATACCACACAGGGAGCCG
CCACCGTCTGGTTGGCATCCCCGGTACTGAAAGAATATGAACAGTACCTGCAACAGCTTCTGAATGCCCC
GCCACTACAGCCGCTGGAAACCGGAATGCAGATGATGCGCACCGCAGACACCCTCTGGCCGGAAAGCCTG
CAACAGCAGGAAGCCAGCAGGATGTGGAGCAACACGCTGAGAAACCGGGCGCAAGCCAGTCCGCAGATGA
AGGGCTGGCAACAAGCGCGGCAGAATTTGCGGGATTTTGCAGATTTGATGATGAAGAAGGAGACGGAGAA
ACAGGGTTTCACCCTATCGTATATCAAAACGGTGACCTGGCAGGCCGAACGGTTACTGAATCAAGAAACA
CCACTGGAGTACCTGCTGACGCAGTACCAGGAGACCCGTACACAGAAGCAGGACACACAGGCGTTGGAAA
AAGAGATCAACGAACGGCTGGACGGGCTGTTAAGCCGCTGGCTGCTGCTGAAAAATACCGGACAGGATAT
GGCAACGGATAACAGAACCGAACCTGTCCATCCAACTCATTGA